PDB entry 1ohu

View 1ohu on RCSB PDB site
Description: structure of caenorhabditis elegans ced-9
Class: apoptosis
Keywords: apoptosis, ced-9, bcl-2 family
Deposited on 2003-05-31, released 2003-08-14
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: 0.212
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Apoptosis regulator ced-9
    Species: Caenorhabditis elegans [TaxId:6239]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41958 (Start-174)
      • engineered (39)
      • engineered (67)
    Domains in SCOPe 2.05: d1ohua_
  • Chain 'B':
    Compound: Apoptosis regulator ced-9
    Species: Caenorhabditis elegans [TaxId:6239]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41958 (Start-174)
      • engineered (39)
      • engineered (67)
      • engineered (96)
    Domains in SCOPe 2.05: d1ohub_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ohuA (A:)
    gkindweeprldiegfvvdyfthrirqngmewfgapglpsgvqpehemmrvmgtifekkh
    aenfetfseqllavprisfslyqdvvrtvgnaqtdqspmsygrliglisfggfvaakmme
    svelqgqvrnlfvytslfiktrirnnwkehnrswddfmtlgkqmkedyeraeaek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ohuA (A:)
    ndweeprldiegfvvdyfthrirqngmewfgapglpsgvqpehemmrvmgtifekkhaen
    fetfseqllavprisfslyqdvvrtvgnpmsygrliglisfggfvaakmmesvelqgqvr
    nlfvytslfiktrirnnwkehnrswddfmtlgkqmkedyeraeaek
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ohuB (B:)
    gkindweeprldiegfvvdyfthrirqngmewfgapglpsgvqpehemmrvmgtifekkh
    aenfetfseqllavprisfslyqdvvrtvgnaqtdqspmsygrliglisfggfvaakmme
    svelqgqvrnlfvytslfiktrirnnwkehnrswddfmtlgkqmkedyeraeaek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ohuB (B:)
    eprldiegfvvdyfthrirqngmewfgapglpsgvqpehemmrvmgtifekkhaenfetf
    seqllavprisfslyqdvvrtvgnaqtdqspmsygrliglisfggfvaakmmesvelqgq
    vrnlfvytslfiktrirnnwkehnrswddfmtlgkqmkedyeraeaek