PDB entry 1ohu

View 1ohu on RCSB PDB site
Description: structure of caenorhabditis elegans ced-9
Deposited on 2003-05-31, released 2003-08-14
The last revision prior to the SCOP 1.69 freeze date was dated 2003-08-14, with a file datestamp of 2003-08-14.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: 0.212
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1ohua_
  • Chain 'B':
    Domains in SCOP 1.69: d1ohub_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ohuA (A:)
    gkindweeprldiegfvvdyfthrirqngmewfgapglpsgvqpehemmrvmgtifekkh
    aenfetfseqllavprisfslyqdvvrtvgnaqtdqspmsygrliglisfggfvaakmme
    svelqgqvrnlfvytslfiktrirnnwkehnrswddfmtlgkqmkedyeraeaek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ohuA (A:)
    ndweeprldiegfvvdyfthrirqngmewfgapglpsgvqpehemmrvmgtifekkhaen
    fetfseqllavprisfslyqdvvrtvgnpmsygrliglisfggfvaakmmesvelqgqvr
    nlfvytslfiktrirnnwkehnrswddfmtlgkqmkedyeraeaek
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ohuB (B:)
    gkindweeprldiegfvvdyfthrirqngmewfgapglpsgvqpehemmrvmgtifekkh
    aenfetfseqllavprisfslyqdvvrtvgnaqtdqspmsygrliglisfggfvaakmme
    svelqgqvrnlfvytslfiktrirnnwkehnrswddfmtlgkqmkedyeraeaek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ohuB (B:)
    eprldiegfvvdyfthrirqngmewfgapglpsgvqpehemmrvmgtifekkhaenfetf
    seqllavprisfslyqdvvrtvgnaqtdqspmsygrliglisfggfvaakmmesvelqgq
    vrnlfvytslfiktrirnnwkehnrswddfmtlgkqmkedyeraeaek