PDB entry 1ohs

View 1ohs on RCSB PDB site
Description: crystal structure of 5-3-ketosteroid isomerase mutant y14f/ d38n from pseudomonas testosteroni complexed with androstanedione
Class: isomerase
Keywords: isomerase, inhibitor, androstanedione
Deposited on 2003-05-30, released 2005-03-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.219
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: steroid delta-isomerase
    Species: PSEUDOMONAS TESTOSTERONI [TaxId:285]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00947
      • engineered mutation (13)
      • engineered mutation (37)
      • conflict (82)
    Domains in SCOPe 2.07: d1ohsa1
  • Chain 'B':
    Compound: steroid delta-isomerase
    Species: PSEUDOMONAS TESTOSTERONI [TaxId:285]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00947 (0-124)
      • engineered mutation (13)
      • engineered mutation (37)
      • conflict (82)
    Domains in SCOPe 2.07: d1ohsb_
  • Chain 'C':
    Compound: steroid delta-isomerase
    Species: PSEUDOMONAS TESTOSTERONI [TaxId:285]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00947
      • engineered mutation (13)
      • engineered mutation (37)
      • conflict (82)
    Domains in SCOPe 2.07: d1ohsc_
  • Chain 'D':
    Compound: steroid delta-isomerase
    Species: PSEUDOMONAS TESTOSTERONI [TaxId:285]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00947 (0-124)
      • engineered mutation (13)
      • engineered mutation (37)
      • conflict (82)
    Domains in SCOPe 2.07: d1ohsd_
  • Heterogens: 5SD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ohsA (A:)
    mntpehmtavvqrfvaalnagdldgivalfaddatvenpvgseprsgtaairefyanslk
    lplaveltqevravaneaafafivsfeyqgrktvvapidhfrfngagkvvsmralfgekn
    ihaga
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ohsB (B:)
    mntpehmtavvqrfvaalnagdldgivalfaddatvenpvgseprsgtaairefyanslk
    lplaveltqevravaneaafafivsfeyqgrktvvapidhfrfngagkvvsmralfgekn
    ihaga
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ohsC (C:)
    mntpehmtavvqrfvaalnagdldgivalfaddatvenpvgseprsgtaairefyanslk
    lplaveltqevravaneaafafivsfeyqgrktvvapidhfrfngagkvvsmralfgekn
    ihaga
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ohsD (D:)
    mntpehmtavvqrfvaalnagdldgivalfaddatvenpvgseprsgtaairefyanslk
    lplaveltqevravaneaafafivsfeyqgrktvvapidhfrfngagkvvsmralfgekn
    ihaga