PDB entry 1ohq

View 1ohq on RCSB PDB site
Description:
Deposited on 2003-05-30, released 2004-03-11
The last revision prior to the SCOP 1.71 freeze date was dated 2004-03-25, with a file datestamp of 2004-03-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.182
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1ohqa_
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1ohqb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ohqA (A:)
    evqllesggglvqpggslrlscaasgfrisdedmgwvrqapgkglewvssiygpsgstyy
    adsvkgrftisrdnskntlylqmnslraedtavyycasaleplseplgfwgqgtlvtvss
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ohqB (B:)
    evqllesggglvqpggslrlscaasgfrisdedmgwvrqapgkglewvssiygpsgstyy
    adsvkgrftisrdnskntlylqmnslraedtavyycasaleplseplgfwgqgtlvtvss