PDB entry 1ohf

View 1ohf on RCSB PDB site
Description: the refined structure of nudaurelia capensis omega virus
Class: virus
Keywords: virus, viral coat, auto-catalytic cleavage, quasiequivalence, nwv, icosahedral virus
Deposited on 2003-05-26, released 2004-02-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-11-17, with a file datestamp of 2010-11-12.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.219
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nudaurelia capensis omega virus capsid protein
    Species: NUDAURELIA CAPENSIS OMEGA VIRUS [TaxId:12541]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q90063
      • see remark 999 (234)
      • see remark 999 (282)
    Domains in SCOPe 2.08: d1ohfa_
  • Chain 'B':
    Compound: nudaurelia capensis omega virus capsid protein
    Species: NUDAURELIA CAPENSIS OMEGA VIRUS [TaxId:12541]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q90063
      • see remark 999 (234)
      • see remark 999 (282)
    Domains in SCOPe 2.08: d1ohfb_
  • Chain 'C':
    Compound: nudaurelia capensis omega virus capsid protein
    Species: NUDAURELIA CAPENSIS OMEGA VIRUS [TaxId:12541]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q90063
      • see remark 999 (234)
      • see remark 999 (282)
    Domains in SCOPe 2.08: d1ohfc_
  • Chain 'D':
    Compound: nudaurelia capensis omega virus capsid protein
    Species: NUDAURELIA CAPENSIS OMEGA VIRUS [TaxId:12541]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q90063
      • see remark 999 (234)
      • see remark 999 (282)
    Domains in SCOPe 2.08: d1ohfd_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ohfA (A:)
    mdsnsasgkrrsrnvriaantvnvapkqrqargrrarsrannidnvtaaaqelgqsldan
    vitfptnvatmpefrswargkldidqdsigwyfkyldpagatesaravgeyskipdglvk
    fsvdaeireiyneecptvsdasipldgaqwslsiisypmfrtayfavanvdnkeisldvt
    ndlivwlnnlaswrdvvdsgqwftfsddptwfvrirvlhptydlpdptegllrtvsdyrl
    tyksitceanmptlvdqgfwigghyaltpiattqnavegsgfvhpfnvtrpgiaagvtlt
    wasmppggsapsgdpawipdsttqfqwrhggfdaptgvitytiprgytmqyfdtttnewn
    gfanpddvvtfgqtggaagtnatititaptvtltilatttsaanvinfrnldaettaasn
    rsevplppltfgqtapnnpkieqtlvkdtlgsylvhskmrnpvfqltpassfgaisftnp
    gfdrnldlpgfggirdsldvnmstavchfrslskscsivtktyqgwegvtnvntpfgqfa
    hsgllkndeilcladdlatrltgvygatdnfaaavlafaanmltsvlkseattsvikelg
    nqatglanqglarlpgllasipgkiaarvrarrdrrraarmnnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ohfA (A:)
    vitfptnvatmpefrswargkldidqdsigwyfkyldpagatesaravgeyskipdglvk
    fsvdaeireiyneecptvsdasipldgaqwslsiisypmfrtayfavanvdnkeisldvt
    ndlivwlnnlaswrdvvdsgqwftfsddptwfvrirvlhptydlpdptegllrtvsdyrl
    tyksitceanmptlvdqgfwigghyaltpiattqnavegsgfvhpfnvtrpgiaagvtlt
    wasmppggsapsgdpawipdsttqfqwrhggfdaptgvitytiprgytmqyfdtttnewn
    gfanpddvvtfgqtggaagtnatititaptvtltilatttsaanvinfrnldaettaasn
    rsevplppltfgqtapnnpkieqtlvkdtlgsylvhskmrnpvfqltpassfgaisftnp
    gfdrnldlpgfggirdsldvnmstavchfrslskscsivtktyqgwegvtnvntpfgqfa
    hsgllkndeilcladdlatrltgvygatdnfaaavlafaanmltsvlkseattsvikel
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ohfB (B:)
    mdsnsasgkrrsrnvriaantvnvapkqrqargrrarsrannidnvtaaaqelgqsldan
    vitfptnvatmpefrswargkldidqdsigwyfkyldpagatesaravgeyskipdglvk
    fsvdaeireiyneecptvsdasipldgaqwslsiisypmfrtayfavanvdnkeisldvt
    ndlivwlnnlaswrdvvdsgqwftfsddptwfvrirvlhptydlpdptegllrtvsdyrl
    tyksitceanmptlvdqgfwigghyaltpiattqnavegsgfvhpfnvtrpgiaagvtlt
    wasmppggsapsgdpawipdsttqfqwrhggfdaptgvitytiprgytmqyfdtttnewn
    gfanpddvvtfgqtggaagtnatititaptvtltilatttsaanvinfrnldaettaasn
    rsevplppltfgqtapnnpkieqtlvkdtlgsylvhskmrnpvfqltpassfgaisftnp
    gfdrnldlpgfggirdsldvnmstavchfrslskscsivtktyqgwegvtnvntpfgqfa
    hsgllkndeilcladdlatrltgvygatdnfaaavlafaanmltsvlkseattsvikelg
    nqatglanqglarlpgllasipgkiaarvrarrdrrraarmnnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ohfB (B:)
    dnvtaaaqelgqsldanvitfptnvatmpefrswargkldidqdsigwyfkyldpagate
    saravgeyskipdglvkfsvdaeireiyneecptvsdasipldgaqwslsiisypmfrta
    yfavanvdnkeisldvtndlivwlnnlaswrdvvdsgqwftfsddptwfvrirvlhptyd
    lpdptegllrtvsdyrltyksitceanmptlvdqgfwigghyaltpiattqnavegsgfv
    hpfnvtrpgiaagvtltwasmppggsapsgdpawipdsttqfqwrhggfdaptgvityti
    prgytmqyfdtttnewngfanpddvvtfgqtggaagtnatititaptvtltilatttsaa
    nvinfrnldaettaasnrsevplppltfgqtapnnpkieqtlvkdtlgsylvhskmrnpv
    fqltpassfgaisftnpgfdrnldlpgfggirdsldvnmstavchfrslskscsivtkty
    qgwegvtnvntpfgqfahsgllkndeilcladdlatrltgvygatdnfaaavlafaanml
    tsvlkse
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ohfC (C:)
    mdsnsasgkrrsrnvriaantvnvapkqrqargrrarsrannidnvtaaaqelgqsldan
    vitfptnvatmpefrswargkldidqdsigwyfkyldpagatesaravgeyskipdglvk
    fsvdaeireiyneecptvsdasipldgaqwslsiisypmfrtayfavanvdnkeisldvt
    ndlivwlnnlaswrdvvdsgqwftfsddptwfvrirvlhptydlpdptegllrtvsdyrl
    tyksitceanmptlvdqgfwigghyaltpiattqnavegsgfvhpfnvtrpgiaagvtlt
    wasmppggsapsgdpawipdsttqfqwrhggfdaptgvitytiprgytmqyfdtttnewn
    gfanpddvvtfgqtggaagtnatititaptvtltilatttsaanvinfrnldaettaasn
    rsevplppltfgqtapnnpkieqtlvkdtlgsylvhskmrnpvfqltpassfgaisftnp
    gfdrnldlpgfggirdsldvnmstavchfrslskscsivtktyqgwegvtnvntpfgqfa
    hsgllkndeilcladdlatrltgvygatdnfaaavlafaanmltsvlkseattsvikelg
    nqatglanqglarlpgllasipgkiaarvrarrdrrraarmnnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ohfC (C:)
    nidnvtaaaqelgqsldanvitfptnvatmpefrswargkldidqdsigwyfkyldpaga
    tesaravgeyskipdglvkfsvdaeireiyneecptvsdldgaqwslsiisypmfrtayf
    avanvdnkeisldvtndlivwlnnlaswrdvvdsgqwftfsddptwfvrirvlhptydlp
    dptegllrtvsdyrltyksitceanmptlvdqgfwigghyaltpiattqnavegsgfvhp
    fnvtrpgiaagvtltwasmppggsapsgdpawipdsttqfqwrhggfdaptgvitytipr
    gytmqyfdtttnewngfanpddvvtfgqtggaagtnatititaptvtltilatttsaanv
    infrnldaettaasnrsevplppltfgqtapnnpkieqtlvkdtlgsylvhskmrnpvfq
    ltpassfgaisftnpgfdrnldlpgfggirdsldvnmstavchfrslskscsivtktyqg
    wegvtnvntpfgqfahsgllkndeilcladdlatrltgvygatdnfaaavlafaanmlts
    vlksetsvikelgnlanqglarlpgllasipgkiaarvrarrdrrraarm
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ohfD (D:)
    mdsnsasgkrrsrnvriaantvnvapkqrqargrrarsrannidnvtaaaqelgqsldan
    vitfptnvatmpefrswargkldidqdsigwyfkyldpagatesaravgeyskipdglvk
    fsvdaeireiyneecptvsdasipldgaqwslsiisypmfrtayfavanvdnkeisldvt
    ndlivwlnnlaswrdvvdsgqwftfsddptwfvrirvlhptydlpdptegllrtvsdyrl
    tyksitceanmptlvdqgfwigghyaltpiattqnavegsgfvhpfnvtrpgiaagvtlt
    wasmppggsapsgdpawipdsttqfqwrhggfdaptgvitytiprgytmqyfdtttnewn
    gfanpddvvtfgqtggaagtnatititaptvtltilatttsaanvinfrnldaettaasn
    rsevplppltfgqtapnnpkieqtlvkdtlgsylvhskmrnpvfqltpassfgaisftnp
    gfdrnldlpgfggirdsldvnmstavchfrslskscsivtktyqgwegvtnvntpfgqfa
    hsgllkndeilcladdlatrltgvygatdnfaaavlafaanmltsvlkseattsvikelg
    nqatglanqglarlpgllasipgkiaarvrarrdrrraarmnnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ohfD (D:)
    idnvtaaaqelgqsldanvitfptnvatmpefrswargkldidqdsigwyfkyldpagat
    esaravgeyskipdglvkfsvdaeireiyneecptvsdasipldgaqwslsiisypmfrt
    ayfavanvdnkeisldvtndlivwlnnlaswrdvvdsgqwftfsddptwfvrirvlhpty
    dlpdptegllrtvsdyrltyksitceanmptlvdqgfwigghyaltpiattqnavegsgf
    vhpfnvtrpgiaagvtltwasmppggsapsgdpawipdsttqfqwrhggfdaptgvityt
    iprgytmqyfdtttnewngfanpddvvtfgqtggaagtnatititaptvtltilatttsa
    anvinfrnldaettaasnrsevplppltfgqtapnnpkieqtlvkdtlgsylvhskmrnp
    vfqltpassfgaisftnpgfdrnldlpgfggirdsldvnmstavchfrslskscsivtkt
    yqgwegvtnvntpfgqfahsgllkndeilcladdlatrltgvygatdnfaaavlafaanm
    ltsvlkseattsvikelgnlpgllasipgkiaarvrarrdrrraarm