PDB entry 1ohe

View 1ohe on RCSB PDB site
Description: structure of cdc14b phosphatase with a peptide ligand
Deposited on 2003-05-24, released 2003-07-24
The last revision prior to the SCOP 1.69 freeze date was dated 2003-07-24, with a file datestamp of 2003-07-24.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.207
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oheA (A:)
    prrrdpqddvylditdrlcfailysrpksasnvhyfsidneleyenfyadfgplnlamvy
    rycckinkklksitmlrkkivhftgsdqrkqanaaflvgcymviylgrtpeeayrilifg
    etsyipfrdaaygscnfyitlldcfhavkkamqygflnfnsfnldeyehyekaengdlnw
    iipdrfiafcgphsrarlesgyhqhspetyiqyfknhnvttiirlnkrmydakrftdagf
    dhhdlffadgstptdaivkefldicenaegaiavhskaglgrtgtliacyimkhyrmtaa
    etiawvricrpgsvigpqqqflvmkqtnlwlegdyfrqklkgqengqh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oheA (A:)
    rdpqddvylditdrlcfailysrpksasnvhyfsidneleyenfyadfgplnlamvyryc
    ckinkklksitmlrkkivhftgsdqrkqanaaflvgcymviylgrtpeeayrilifgets
    yipfrdaaygscnfyitlldcfhavkkamqygflnfnsfnldeyehyekaengdlnwiip
    drfiafcgphsrarlesgyhqhspetyiqyfknhnvttiirlnkrmydakrftdagfdhh
    dlffadgstptdaivkefldicenaegaiavhskaglgrtgtliacyimkhyrmtaaeti
    awvricrpgsvigpqqqflvmkqtnlwlegdyfrqklkg