PDB entry 1oh5

View 1oh5 on RCSB PDB site
Description:
Deposited on 2003-05-23, released 2003-08-08
The last revision prior to the SCOP 1.71 freeze date was dated 2003-08-08, with a file datestamp of 2003-08-08.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.22781
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oh5A (A:)
    msaienfdahtpmmqqylrlkaqhpeillfyrmgdfyelfyddakrasqlldisltkrga
    sagepipmagipyhavenylaklvnqgesvaiceqigdpatskgpverkvvrivtpgtis
    deallqerqdnllaaiwqdskgfgyatldissgrfrlsepadretmaaelqrtnpaelly
    aedfaemsliegrrglrrrplwefeidtarqqlnlqfgtrdlvgfgvenaprglcaagcl
    lqyakdtqrttlphirsitmereqdsiimdaatrrnleitqnlaggaentlasvldctvt
    pmgsrmlkrwlhmpvrdtrvllerqqtigalqdftaglqpvlrqvgdlerilarlalrta
    rprdlarmrhafqqlpelraqletvdsapvqalrekmgefaelrdlleraiidtppvlvr
    dggviasgyneeldewraladgatdylerlevrerertgldtlkvgfnavhgyyiqisrg
    qshlapinymrrqtlknaeryiipelkeyedkvltskgkalalekqlyeelfdlllphle
    alqqsasalaeldvlvnlaeraytlnytcptfidkpgiritegrhpvveqvlnepfianp
    lnlspqrrmliitgpnmggkstymrqtalialmayigsyvpaqkveigpidriftrvgaa
    ddlasgrstfmvemtetanilhnateyslvlmdeigrgtstydglslawacaenlankik
    altlfathyfeltqlpekmegvanvhldalehgdtiafmhsvqdgaasksyglavaalag
    vpkevikrarqklrelesis
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oh5A (A:)
    saienfdahtpmmqqylrlkaqhpeillfyrmgdfyelfyddakrasqlldisltkrgas
    agepipmagipyhavenylaklvnqgesvaiceqigdpatskgpverkvvrivtpgtisd
    eallqerqdnllaaiwqdskgfgyatldissgrfrlsepadretmaaelqrtnpaellya
    edfaemsliegrrglrrrplwefeidtarqqlnlqfgtrdlvgfgvenaprglcaagcll
    qyakdtqrttlphirsitmereqdsiimdaatrrnleitqnlaggaentlasvldctvtp
    mgsrmlkrwlhmpvrdtrvllerqqtigalqdftaglqpvlrqvgdlerilarlalrtar
    prdlarmrhafqqlpelraqletvdsapvqalrekmgefaelrdlleraiidtppvlvrd
    ggviasgyneeldewraladgatdylerlevrerertgldtlkvgfnavhgyyiqisrgq
    shlapinymrrqtlknaeryiipelkeyedkvltskgkalalekqlyeelfdlllphlea
    lqqsasalaeldvlvnlaeraytlnytcptfidkpgiritegrhpvveqvlnepfianpl
    nlspqrrmliitgpnmggkstymrqtalialmayigsyvpaqkveigpidriftrvgfmv
    emtetanilhnateyslvlmdeigrgtstydglslawacaenlankikaltlfathyfel
    tqlpekmegvanvhldalehgdtiafmhsvqdgaasksyglavaalagvpkevikrarqk
    lrelesis
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1oh5B (B:)
    msaienfdahtpmmqqylrlkaqhpeillfyrmgdfyelfyddakrasqlldisltkrga
    sagepipmagipyhavenylaklvnqgesvaiceqigdpatskgpverkvvrivtpgtis
    deallqerqdnllaaiwqdskgfgyatldissgrfrlsepadretmaaelqrtnpaelly
    aedfaemsliegrrglrrrplwefeidtarqqlnlqfgtrdlvgfgvenaprglcaagcl
    lqyakdtqrttlphirsitmereqdsiimdaatrrnleitqnlaggaentlasvldctvt
    pmgsrmlkrwlhmpvrdtrvllerqqtigalqdftaglqpvlrqvgdlerilarlalrta
    rprdlarmrhafqqlpelraqletvdsapvqalrekmgefaelrdlleraiidtppvlvr
    dggviasgyneeldewraladgatdylerlevrerertgldtlkvgfnavhgyyiqisrg
    qshlapinymrrqtlknaeryiipelkeyedkvltskgkalalekqlyeelfdlllphle
    alqqsasalaeldvlvnlaeraytlnytcptfidkpgiritegrhpvveqvlnepfianp
    lnlspqrrmliitgpnmggkstymrqtalialmayigsyvpaqkveigpidriftrvgaa
    ddlasgrstfmvemtetanilhnateyslvlmdeigrgtstydglslawacaenlankik
    altlfathyfeltqlpekmegvanvhldalehgdtiafmhsvqdgaasksyglavaalag
    vpkevikrarqklrelesis
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oh5B (B:)
    mqqylrlkaqhpeillfyrmgdfyelfyddakrasqlldisltpmagipyhavenylakl
    vnqgesvaicerkvvrivtpgtisdeallqerqdnllaaiwqdskgfgyatldissgrfr
    lsepadretmaaelqrtnpaellyaedfaemsliegrrglrrrplwefeidtarqqlnlq
    fgtrdlvgfgvenaprglcaagcllqyakdtqrttlphirsitmereqdsiimdaatrrn
    leitqnlaggaentlasvldctvtpmgsrmlkrwlhmpvrdtrvllerqqtigalqdfta
    glqpvlrqvgdlerilarlalrtarprdlarmrhafqqlpelraqletvdsapvqalrek
    mgefaelrdlleraiidtppvlvrdggviasgyneeldewraladgatdylerlevrere
    rtgldtlkvgfnavhgyyiqisrgqshlapinymrrqtlknaeryiipelkeyedkvlts
    kgkalalekqlyeelfdlllphlealqqsasalaeldvlvnlaeraytlnytcptfidkp
    giritegrhpvveqvlnepfianplnlspqrrmliitgpnmggkstymrqtalialmayi
    gsyvpaqkveigpidriftrvgtfmvemtetanilhnateyslvlmdeigrgtstydgls
    lawacaenlankikaltlfathyfeltqlpekmegvanvhldalehgdtiafmhsvqdga
    asksyglavaalagvpkevikrarqklrelesis