PDB entry 1oh1

View 1oh1 on RCSB PDB site
Description: solution structure of staphostatin a form staphylococcus aureus confirms the discovery of a novel class of cysteine proteinase inhibitors.
Deposited on 2003-05-21, released 2003-11-20
The last revision prior to the SCOP 1.67 freeze date was dated 2003-11-20, with a file datestamp of 2003-11-20.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1oh1a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oh1A (A:)
    gsmeqfelfsidkfkcnseakyylniiegewhpqdlndsplkfilstsddsdyickyint
    ehkqltlynknnssivieifipndnkilltimntealgtsprmtfikhk