PDB entry 1ogy

View 1ogy on RCSB PDB site
Description: crystal structure of the heterodimeric nitrate reductase from rhodobacter sphaeroides
Class: oxidoreductase
Keywords: nitrate reductase, oxidoreductase
Deposited on 2003-05-19, released 2003-10-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.2504
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: periplasmic nitrate reductase
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ogya1, d1ogya2
  • Chain 'B':
    Compound: diheme cytochrome c napb molecule: nitrate reductase
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ogyb_
  • Chain 'C':
    Compound: periplasmic nitrate reductase
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ogyc1, d1ogyc2
  • Chain 'D':
    Compound: diheme cytochrome c napb molecule: nitrate reductase
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ogyd_
  • Chain 'E':
    Compound: periplasmic nitrate reductase
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ogye1, d1ogye2
  • Chain 'F':
    Compound: diheme cytochrome c napb molecule: nitrate reductase
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ogyf_
  • Chain 'G':
    Compound: periplasmic nitrate reductase
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ogyg1, d1ogyg2
  • Chain 'H':
    Compound: diheme cytochrome c napb molecule: nitrate reductase
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ogyh_
  • Chain 'I':
    Compound: periplasmic nitrate reductase
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ogyi1, d1ogyi2
  • Chain 'J':
    Compound: diheme cytochrome c napb molecule: nitrate reductase
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ogyj_
  • Chain 'K':
    Compound: periplasmic nitrate reductase
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ogyk1, d1ogyk2
  • Chain 'L':
    Compound: diheme cytochrome c napb molecule: nitrate reductase
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ogyl_
  • Chain 'M':
    Compound: periplasmic nitrate reductase
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ogym1, d1ogym2
  • Chain 'N':
    Compound: diheme cytochrome c napb molecule: nitrate reductase
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ogyn_
  • Chain 'O':
    Compound: periplasmic nitrate reductase
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ogyo1, d1ogyo2
  • Chain 'P':
    Compound: diheme cytochrome c napb molecule: nitrate reductase
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ogyp_
  • Heterogens: SF4, MO, MGD, HEC

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ogyA (A:)
    qpvtggaealrirwskapcrfcgtgcgvmvgtrdgqvvathgdtqaevnrglncvkgyfl
    skimygedrlttpllrmkdgvyhkegefapvswdeafdvmaaqaklvlkekapeavgmfg
    sgqwtiwegyaasklmragfrsnnldpnarhcmasaatafmrtfgmdepmgcyddfeaad
    afvlwgsnmaemhpilwsrltdrrlshehvrvavlstfthrssdlsdtpiifrpgtdrai
    lnyiahhiistgrvnrdfvdrhtnfalgatdigyglrpehqlqlaakgaadagamtptdf
    etfaalvseytlekaaeisgvepalleelaelyadpdrkwmslwtmgfnqhvrgvwanhm
    vynlhlltgkisepgnspfsltgqpfacgtarevgtfahrlpadmvvtnpehrahaeeiw
    klpagllpdwvgahaveqdrklhdgeinfywvqvnnnmqaapnidqetypgyrnpenfiv
    vsdayptvtgraadlvlpaamwvekegaygnaerrthfwhqlveapgearsdlwqlmefs
    krfttdevwpeeilsaapayrgktlfevlfangsvdrfpasdvnpdhanheaalfgfypq
    kglfeeyaafgrghghdlapfdtyhevrglhwpvvegeetrwryregfdpyvkpgeglrf
    ygkpdgravilgvpyeppaespdeefgfwlvtgrvlehwhsgsmtlrwpelykafpgavc
    fmhpedarsrglnrgsevrvisrrgeirtrletrgrnrmprgvvfvpwfdasqlinkvtl
    dandpisrqtdfkkcavkieav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ogyA (A:)
    irwskapcrfcgtgcgvmvgtrdgqvvathgdtqaevnrglncvkgyflskimygedrlt
    tpllrmkdgvyhkegefapvswdeafdvmaaqaklvlkekapeavgmfgsgqwtiwegya
    asklmragfrsnnldpnarhcmasaatafmrtfgmdepmgcyddfeaadafvlwgsnmae
    mhpilwsrltdrrlshehvrvavlstfthrssdlsdtpiifrpgtdrailnyiahhiist
    grvnrdfvdrhtnfalgatdigyglrpehqlqlaakgaadagamtptdfetfaalvseyt
    lekaaeisgvepalleelaelyadpdrkwmslwtmgfnqhvrgvwanhmvynlhlltgki
    sepgnspfsltgqpfacgtarevgtfahrlpadmvvtnpehrahaeeiwklpagllpdwv
    gahaveqdrklhdgeinfywvqvnnnmqaapnidqetypgyrnpenfivvsdayptvtgr
    aadlvlpaamwvekegaygnaerrthfwhqlveapgearsdlwqlmefskrfttdevwpe
    eilsaapayrgktlfevlfangsvdrfpasdvnpdhanheaalfgfypqkglfeeyaafg
    rghghdlapfdtyhevrglhwpvvegeetrwryregfdpyvkpgeglrfygkpdgravil
    gvpyeppaespdeefgfwlvtgrvlehwhsgsmtlrwpelykafpgavcfmhpedarsrg
    lnrgsevrvisrrgeirtrletrgrnrmprgvvfvpwfdasqlinkvtldandpisrqtd
    fkkcavkiea
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ogyB (B:)
    qdaprltgadrpmsevaapplpetitddrrvgrnypeqppviphsiegyqlsvnanrcle
    chrrqysglvaapmisithfqdregqmladvsprryfctachvpqtnaqplvtnefrdml
    tlmpasneae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ogyB (B:)
    daprltgadrpmsevaapplpetitddrrvgrnypeqppviphsiegyqlsvnanrclec
    hrrqysglvaapmisithfqdregqmladvsprryfctachvpqtnaqplvtnefrdmlt
    lmpasne
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ogyC (C:)
    qpvtggaealrirwskapcrfcgtgcgvmvgtrdgqvvathgdtqaevnrglncvkgyfl
    skimygedrlttpllrmkdgvyhkegefapvswdeafdvmaaqaklvlkekapeavgmfg
    sgqwtiwegyaasklmragfrsnnldpnarhcmasaatafmrtfgmdepmgcyddfeaad
    afvlwgsnmaemhpilwsrltdrrlshehvrvavlstfthrssdlsdtpiifrpgtdrai
    lnyiahhiistgrvnrdfvdrhtnfalgatdigyglrpehqlqlaakgaadagamtptdf
    etfaalvseytlekaaeisgvepalleelaelyadpdrkwmslwtmgfnqhvrgvwanhm
    vynlhlltgkisepgnspfsltgqpfacgtarevgtfahrlpadmvvtnpehrahaeeiw
    klpagllpdwvgahaveqdrklhdgeinfywvqvnnnmqaapnidqetypgyrnpenfiv
    vsdayptvtgraadlvlpaamwvekegaygnaerrthfwhqlveapgearsdlwqlmefs
    krfttdevwpeeilsaapayrgktlfevlfangsvdrfpasdvnpdhanheaalfgfypq
    kglfeeyaafgrghghdlapfdtyhevrglhwpvvegeetrwryregfdpyvkpgeglrf
    ygkpdgravilgvpyeppaespdeefgfwlvtgrvlehwhsgsmtlrwpelykafpgavc
    fmhpedarsrglnrgsevrvisrrgeirtrletrgrnrmprgvvfvpwfdasqlinkvtl
    dandpisrqtdfkkcavkieav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ogyC (C:)
    irwskapcrfcgtgcgvmvgtrdgqvvathgdtqaevnrglncvkgyflskimygedrlt
    tpllrmkdgvyhkegefapvswdeafdvmaaqaklvlkekapeavgmfgsgqwtiwegya
    asklmragfrsnnldpnarhcmasaatafmrtfgmdepmgcyddfeaadafvlwgsnmae
    mhpilwsrltdrrlshehvrvavlstfthrssdlsdtpiifrpgtdrailnyiahhiist
    grvnrdfvdrhtnfalgatdigyglrpehqlqlaakgaadagamtptdfetfaalvseyt
    lekaaeisgvepalleelaelyadpdrkwmslwtmgfnqhvrgvwanhmvynlhlltgki
    sepgnspfsltgqpfacgtarevgtfahrlpadmvvtnpehrahaeeiwklpagllpdwv
    gahaveqdrklhdgeinfywvqvnnnmqaapnidqetypgyrnpenfivvsdayptvtgr
    aadlvlpaamwvekegaygnaerrthfwhqlveapgearsdlwqlmefskrfttdevwpe
    eilsaapayrgktlfevlfangsvdrfpasdvnpdhanheaalfgfypqkglfeeyaafg
    rghghdlapfdtyhevrglhwpvvegeetrwryregfdpyvkpgeglrfygkpdgravil
    gvpyeppaespdeefgfwlvtgrvlehwhsgsmtlrwpelykafpgavcfmhpedarsrg
    lnrgsevrvisrrgeirtrletrgrnrmprgvvfvpwfdasqlinkvtldandpisrqtd
    fkkcavkiea
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ogyD (D:)
    qdaprltgadrpmsevaapplpetitddrrvgrnypeqppviphsiegyqlsvnanrcle
    chrrqysglvaapmisithfqdregqmladvsprryfctachvpqtnaqplvtnefrdml
    tlmpasneae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ogyD (D:)
    daprltgadrpmsevaapplpetitddrrvgrnypeqppviphsiegyqlsvnanrclec
    hrrqysglvaapmisithfqdregqmladvsprryfctachvpqtnaqplvtnefrdmlt
    lmpasne
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1ogyE (E:)
    qpvtggaealrirwskapcrfcgtgcgvmvgtrdgqvvathgdtqaevnrglncvkgyfl
    skimygedrlttpllrmkdgvyhkegefapvswdeafdvmaaqaklvlkekapeavgmfg
    sgqwtiwegyaasklmragfrsnnldpnarhcmasaatafmrtfgmdepmgcyddfeaad
    afvlwgsnmaemhpilwsrltdrrlshehvrvavlstfthrssdlsdtpiifrpgtdrai
    lnyiahhiistgrvnrdfvdrhtnfalgatdigyglrpehqlqlaakgaadagamtptdf
    etfaalvseytlekaaeisgvepalleelaelyadpdrkwmslwtmgfnqhvrgvwanhm
    vynlhlltgkisepgnspfsltgqpfacgtarevgtfahrlpadmvvtnpehrahaeeiw
    klpagllpdwvgahaveqdrklhdgeinfywvqvnnnmqaapnidqetypgyrnpenfiv
    vsdayptvtgraadlvlpaamwvekegaygnaerrthfwhqlveapgearsdlwqlmefs
    krfttdevwpeeilsaapayrgktlfevlfangsvdrfpasdvnpdhanheaalfgfypq
    kglfeeyaafgrghghdlapfdtyhevrglhwpvvegeetrwryregfdpyvkpgeglrf
    ygkpdgravilgvpyeppaespdeefgfwlvtgrvlehwhsgsmtlrwpelykafpgavc
    fmhpedarsrglnrgsevrvisrrgeirtrletrgrnrmprgvvfvpwfdasqlinkvtl
    dandpisrqtdfkkcavkieav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ogyE (E:)
    irwskapcrfcgtgcgvmvgtrdgqvvathgdtqaevnrglncvkgyflskimygedrlt
    tpllrmkdgvyhkegefapvswdeafdvmaaqaklvlkekapeavgmfgsgqwtiwegya
    asklmragfrsnnldpnarhcmasaatafmrtfgmdepmgcyddfeaadafvlwgsnmae
    mhpilwsrltdrrlshehvrvavlstfthrssdlsdtpiifrpgtdrailnyiahhiist
    grvnrdfvdrhtnfalgatdigyglrpehqlqlaakgaadagamtptdfetfaalvseyt
    lekaaeisgvepalleelaelyadpdrkwmslwtmgfnqhvrgvwanhmvynlhlltgki
    sepgnspfsltgqpfacgtarevgtfahrlpadmvvtnpehrahaeeiwklpagllpdwv
    gahaveqdrklhdgeinfywvqvnnnmqaapnidqetypgyrnpenfivvsdayptvtgr
    aadlvlpaamwvekegaygnaerrthfwhqlveapgearsdlwqlmefskrfttdevwpe
    eilsaapayrgktlfevlfangsvdrfpasdvnpdhanheaalfgfypqkglfeeyaafg
    rghghdlapfdtyhevrglhwpvvegeetrwryregfdpyvkpgeglrfygkpdgravil
    gvpyeppaespdeefgfwlvtgrvlehwhsgsmtlrwpelykafpgavcfmhpedarsrg
    lnrgsevrvisrrgeirtrletrgrnrmprgvvfvpwfdasqlinkvtldandpisrqtd
    fkkcavkiea
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1ogyF (F:)
    qdaprltgadrpmsevaapplpetitddrrvgrnypeqppviphsiegyqlsvnanrcle
    chrrqysglvaapmisithfqdregqmladvsprryfctachvpqtnaqplvtnefrdml
    tlmpasneae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ogyF (F:)
    daprltgadrpmsevaapplpetitddrrvgrnypeqppviphsiegyqlsvnanrclec
    hrrqysglvaapmisithfqdregqmladvsprryfctachvpqtnaqplvtnefrdmlt
    lmpasne
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1ogyG (G:)
    qpvtggaealrirwskapcrfcgtgcgvmvgtrdgqvvathgdtqaevnrglncvkgyfl
    skimygedrlttpllrmkdgvyhkegefapvswdeafdvmaaqaklvlkekapeavgmfg
    sgqwtiwegyaasklmragfrsnnldpnarhcmasaatafmrtfgmdepmgcyddfeaad
    afvlwgsnmaemhpilwsrltdrrlshehvrvavlstfthrssdlsdtpiifrpgtdrai
    lnyiahhiistgrvnrdfvdrhtnfalgatdigyglrpehqlqlaakgaadagamtptdf
    etfaalvseytlekaaeisgvepalleelaelyadpdrkwmslwtmgfnqhvrgvwanhm
    vynlhlltgkisepgnspfsltgqpfacgtarevgtfahrlpadmvvtnpehrahaeeiw
    klpagllpdwvgahaveqdrklhdgeinfywvqvnnnmqaapnidqetypgyrnpenfiv
    vsdayptvtgraadlvlpaamwvekegaygnaerrthfwhqlveapgearsdlwqlmefs
    krfttdevwpeeilsaapayrgktlfevlfangsvdrfpasdvnpdhanheaalfgfypq
    kglfeeyaafgrghghdlapfdtyhevrglhwpvvegeetrwryregfdpyvkpgeglrf
    ygkpdgravilgvpyeppaespdeefgfwlvtgrvlehwhsgsmtlrwpelykafpgavc
    fmhpedarsrglnrgsevrvisrrgeirtrletrgrnrmprgvvfvpwfdasqlinkvtl
    dandpisrqtdfkkcavkieav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ogyG (G:)
    irwskapcrfcgtgcgvmvgtrdgqvvathgdtqaevnrglncvkgyflskimygedrlt
    tpllrmkdgvyhkegefapvswdeafdvmaaqaklvlkekapeavgmfgsgqwtiwegya
    asklmragfrsnnldpnarhcmasaatafmrtfgmdepmgcyddfeaadafvlwgsnmae
    mhpilwsrltdrrlshehvrvavlstfthrssdlsdtpiifrpgtdrailnyiahhiist
    grvnrdfvdrhtnfalgatdigyglrpehqlqlaakgaadagamtptdfetfaalvseyt
    lekaaeisgvepalleelaelyadpdrkwmslwtmgfnqhvrgvwanhmvynlhlltgki
    sepgnspfsltgqpfacgtarevgtfahrlpadmvvtnpehrahaeeiwklpagllpdwv
    gahaveqdrklhdgeinfywvqvnnnmqaapnidqetypgyrnpenfivvsdayptvtgr
    aadlvlpaamwvekegaygnaerrthfwhqlveapgearsdlwqlmefskrfttdevwpe
    eilsaapayrgktlfevlfangsvdrfpasdvnpdhanheaalfgfypqkglfeeyaafg
    rghghdlapfdtyhevrglhwpvvegeetrwryregfdpyvkpgeglrfygkpdgravil
    gvpyeppaespdeefgfwlvtgrvlehwhsgsmtlrwpelykafpgavcfmhpedarsrg
    lnrgsevrvisrrgeirtrletrgrnrmprgvvfvpwfdasqlinkvtldandpisrqtd
    fkkcavkiea
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1ogyH (H:)
    qdaprltgadrpmsevaapplpetitddrrvgrnypeqppviphsiegyqlsvnanrcle
    chrrqysglvaapmisithfqdregqmladvsprryfctachvpqtnaqplvtnefrdml
    tlmpasneae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ogyH (H:)
    daprltgadrpmsevaapplpetitddrrvgrnypeqppviphsiegyqlsvnanrclec
    hrrqysglvaapmisithfqdregqmladvsprryfctachvpqtnaqplvtnefrdmlt
    lmpasne
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1ogyI (I:)
    qpvtggaealrirwskapcrfcgtgcgvmvgtrdgqvvathgdtqaevnrglncvkgyfl
    skimygedrlttpllrmkdgvyhkegefapvswdeafdvmaaqaklvlkekapeavgmfg
    sgqwtiwegyaasklmragfrsnnldpnarhcmasaatafmrtfgmdepmgcyddfeaad
    afvlwgsnmaemhpilwsrltdrrlshehvrvavlstfthrssdlsdtpiifrpgtdrai
    lnyiahhiistgrvnrdfvdrhtnfalgatdigyglrpehqlqlaakgaadagamtptdf
    etfaalvseytlekaaeisgvepalleelaelyadpdrkwmslwtmgfnqhvrgvwanhm
    vynlhlltgkisepgnspfsltgqpfacgtarevgtfahrlpadmvvtnpehrahaeeiw
    klpagllpdwvgahaveqdrklhdgeinfywvqvnnnmqaapnidqetypgyrnpenfiv
    vsdayptvtgraadlvlpaamwvekegaygnaerrthfwhqlveapgearsdlwqlmefs
    krfttdevwpeeilsaapayrgktlfevlfangsvdrfpasdvnpdhanheaalfgfypq
    kglfeeyaafgrghghdlapfdtyhevrglhwpvvegeetrwryregfdpyvkpgeglrf
    ygkpdgravilgvpyeppaespdeefgfwlvtgrvlehwhsgsmtlrwpelykafpgavc
    fmhpedarsrglnrgsevrvisrrgeirtrletrgrnrmprgvvfvpwfdasqlinkvtl
    dandpisrqtdfkkcavkieav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ogyI (I:)
    irwskapcrfcgtgcgvmvgtrdgqvvathgdtqaevnrglncvkgyflskimygedrlt
    tpllrmkdgvyhkegefapvswdeafdvmaaqaklvlkekapeavgmfgsgqwtiwegya
    asklmragfrsnnldpnarhcmasaatafmrtfgmdepmgcyddfeaadafvlwgsnmae
    mhpilwsrltdrrlshehvrvavlstfthrssdlsdtpiifrpgtdrailnyiahhiist
    grvnrdfvdrhtnfalgatdigyglrpehqlqlaakgaadagamtptdfetfaalvseyt
    lekaaeisgvepalleelaelyadpdrkwmslwtmgfnqhvrgvwanhmvynlhlltgki
    sepgnspfsltgqpfacgtarevgtfahrlpadmvvtnpehrahaeeiwklpagllpdwv
    gahaveqdrklhdgeinfywvqvnnnmqaapnidqetypgyrnpenfivvsdayptvtgr
    aadlvlpaamwvekegaygnaerrthfwhqlveapgearsdlwqlmefskrfttdevwpe
    eilsaapayrgktlfevlfangsvdrfpasdvnpdhanheaalfgfypqkglfeeyaafg
    rghghdlapfdtyhevrglhwpvvegeetrwryregfdpyvkpgeglrfygkpdgravil
    gvpyeppaespdeefgfwlvtgrvlehwhsgsmtlrwpelykafpgavcfmhpedarsrg
    lnrgsevrvisrrgeirtrletrgrnrmprgvvfvpwfdasqlinkvtldandpisrqtd
    fkkcavkiea
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1ogyJ (J:)
    qdaprltgadrpmsevaapplpetitddrrvgrnypeqppviphsiegyqlsvnanrcle
    chrrqysglvaapmisithfqdregqmladvsprryfctachvpqtnaqplvtnefrdml
    tlmpasneae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ogyJ (J:)
    daprltgadrpmsevaapplpetitddrrvgrnypeqppviphsiegyqlsvnanrclec
    hrrqysglvaapmisithfqdregqmladvsprryfctachvpqtnaqplvtnefrdmlt
    lmpasne
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1ogyK (K:)
    qpvtggaealrirwskapcrfcgtgcgvmvgtrdgqvvathgdtqaevnrglncvkgyfl
    skimygedrlttpllrmkdgvyhkegefapvswdeafdvmaaqaklvlkekapeavgmfg
    sgqwtiwegyaasklmragfrsnnldpnarhcmasaatafmrtfgmdepmgcyddfeaad
    afvlwgsnmaemhpilwsrltdrrlshehvrvavlstfthrssdlsdtpiifrpgtdrai
    lnyiahhiistgrvnrdfvdrhtnfalgatdigyglrpehqlqlaakgaadagamtptdf
    etfaalvseytlekaaeisgvepalleelaelyadpdrkwmslwtmgfnqhvrgvwanhm
    vynlhlltgkisepgnspfsltgqpfacgtarevgtfahrlpadmvvtnpehrahaeeiw
    klpagllpdwvgahaveqdrklhdgeinfywvqvnnnmqaapnidqetypgyrnpenfiv
    vsdayptvtgraadlvlpaamwvekegaygnaerrthfwhqlveapgearsdlwqlmefs
    krfttdevwpeeilsaapayrgktlfevlfangsvdrfpasdvnpdhanheaalfgfypq
    kglfeeyaafgrghghdlapfdtyhevrglhwpvvegeetrwryregfdpyvkpgeglrf
    ygkpdgravilgvpyeppaespdeefgfwlvtgrvlehwhsgsmtlrwpelykafpgavc
    fmhpedarsrglnrgsevrvisrrgeirtrletrgrnrmprgvvfvpwfdasqlinkvtl
    dandpisrqtdfkkcavkieav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ogyK (K:)
    irwskapcrfcgtgcgvmvgtrdgqvvathgdtqaevnrglncvkgyflskimygedrlt
    tpllrmkdgvyhkegefapvswdeafdvmaaqaklvlkekapeavgmfgsgqwtiwegya
    asklmragfrsnnldpnarhcmasaatafmrtfgmdepmgcyddfeaadafvlwgsnmae
    mhpilwsrltdrrlshehvrvavlstfthrssdlsdtpiifrpgtdrailnyiahhiist
    grvnrdfvdrhtnfalgatdigyglrpehqlqlaakgaadagamtptdfetfaalvseyt
    lekaaeisgvepalleelaelyadpdrkwmslwtmgfnqhvrgvwanhmvynlhlltgki
    sepgnspfsltgqpfacgtarevgtfahrlpadmvvtnpehrahaeeiwklpagllpdwv
    gahaveqdrklhdgeinfywvqvnnnmqaapnidqetypgyrnpenfivvsdayptvtgr
    aadlvlpaamwvekegaygnaerrthfwhqlveapgearsdlwqlmefskrfttdevwpe
    eilsaapayrgktlfevlfangsvdrfpasdvnpdhanheaalfgfypqkglfeeyaafg
    rghghdlapfdtyhevrglhwpvvegeetrwryregfdpyvkpgeglrfygkpdgravil
    gvpyeppaespdeefgfwlvtgrvlehwhsgsmtlrwpelykafpgavcfmhpedarsrg
    lnrgsevrvisrrgeirtrletrgrnrmprgvvfvpwfdasqlinkvtldandpisrqtd
    fkkcavkiea
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1ogyL (L:)
    qdaprltgadrpmsevaapplpetitddrrvgrnypeqppviphsiegyqlsvnanrcle
    chrrqysglvaapmisithfqdregqmladvsprryfctachvpqtnaqplvtnefrdml
    tlmpasneae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ogyL (L:)
    daprltgadrpmsevaapplpetitddrrvgrnypeqppviphsiegyqlsvnanrclec
    hrrqysglvaapmisithfqdregqmladvsprryfctachvpqtnaqplvtnefrdmlt
    lmpasne
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1ogyM (M:)
    qpvtggaealrirwskapcrfcgtgcgvmvgtrdgqvvathgdtqaevnrglncvkgyfl
    skimygedrlttpllrmkdgvyhkegefapvswdeafdvmaaqaklvlkekapeavgmfg
    sgqwtiwegyaasklmragfrsnnldpnarhcmasaatafmrtfgmdepmgcyddfeaad
    afvlwgsnmaemhpilwsrltdrrlshehvrvavlstfthrssdlsdtpiifrpgtdrai
    lnyiahhiistgrvnrdfvdrhtnfalgatdigyglrpehqlqlaakgaadagamtptdf
    etfaalvseytlekaaeisgvepalleelaelyadpdrkwmslwtmgfnqhvrgvwanhm
    vynlhlltgkisepgnspfsltgqpfacgtarevgtfahrlpadmvvtnpehrahaeeiw
    klpagllpdwvgahaveqdrklhdgeinfywvqvnnnmqaapnidqetypgyrnpenfiv
    vsdayptvtgraadlvlpaamwvekegaygnaerrthfwhqlveapgearsdlwqlmefs
    krfttdevwpeeilsaapayrgktlfevlfangsvdrfpasdvnpdhanheaalfgfypq
    kglfeeyaafgrghghdlapfdtyhevrglhwpvvegeetrwryregfdpyvkpgeglrf
    ygkpdgravilgvpyeppaespdeefgfwlvtgrvlehwhsgsmtlrwpelykafpgavc
    fmhpedarsrglnrgsevrvisrrgeirtrletrgrnrmprgvvfvpwfdasqlinkvtl
    dandpisrqtdfkkcavkieav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ogyM (M:)
    irwskapcrfcgtgcgvmvgtrdgqvvathgdtqaevnrglncvkgyflskimygedrlt
    tpllrmkdgvyhkegefapvswdeafdvmaaqaklvlkekapeavgmfgsgqwtiwegya
    asklmragfrsnnldpnarhcmasaatafmrtfgmdepmgcyddfeaadafvlwgsnmae
    mhpilwsrltdrrlshehvrvavlstfthrssdlsdtpiifrpgtdrailnyiahhiist
    grvnrdfvdrhtnfalgatdigyglrpehqlqlaakgaadagamtptdfetfaalvseyt
    lekaaeisgvepalleelaelyadpdrkwmslwtmgfnqhvrgvwanhmvynlhlltgki
    sepgnspfsltgqpfacgtarevgtfahrlpadmvvtnpehrahaeeiwklpagllpdwv
    gahaveqdrklhdgeinfywvqvnnnmqaapnidqetypgyrnpenfivvsdayptvtgr
    aadlvlpaamwvekegaygnaerrthfwhqlveapgearsdlwqlmefskrfttdevwpe
    eilsaapayrgktlfevlfangsvdrfpasdvnpdhanheaalfgfypqkglfeeyaafg
    rghghdlapfdtyhevrglhwpvvegeetrwryregfdpyvkpgeglrfygkpdgravil
    gvpyeppaespdeefgfwlvtgrvlehwhsgsmtlrwpelykafpgavcfmhpedarsrg
    lnrgsevrvisrrgeirtrletrgrnrmprgvvfvpwfdasqlinkvtldandpisrqtd
    fkkcavkiea
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1ogyN (N:)
    qdaprltgadrpmsevaapplpetitddrrvgrnypeqppviphsiegyqlsvnanrcle
    chrrqysglvaapmisithfqdregqmladvsprryfctachvpqtnaqplvtnefrdml
    tlmpasneae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ogyN (N:)
    daprltgadrpmsevaapplpetitddrrvgrnypeqppviphsiegyqlsvnanrclec
    hrrqysglvaapmisithfqdregqmladvsprryfctachvpqtnaqplvtnefrdmlt
    lmpasne
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1ogyO (O:)
    qpvtggaealrirwskapcrfcgtgcgvmvgtrdgqvvathgdtqaevnrglncvkgyfl
    skimygedrlttpllrmkdgvyhkegefapvswdeafdvmaaqaklvlkekapeavgmfg
    sgqwtiwegyaasklmragfrsnnldpnarhcmasaatafmrtfgmdepmgcyddfeaad
    afvlwgsnmaemhpilwsrltdrrlshehvrvavlstfthrssdlsdtpiifrpgtdrai
    lnyiahhiistgrvnrdfvdrhtnfalgatdigyglrpehqlqlaakgaadagamtptdf
    etfaalvseytlekaaeisgvepalleelaelyadpdrkwmslwtmgfnqhvrgvwanhm
    vynlhlltgkisepgnspfsltgqpfacgtarevgtfahrlpadmvvtnpehrahaeeiw
    klpagllpdwvgahaveqdrklhdgeinfywvqvnnnmqaapnidqetypgyrnpenfiv
    vsdayptvtgraadlvlpaamwvekegaygnaerrthfwhqlveapgearsdlwqlmefs
    krfttdevwpeeilsaapayrgktlfevlfangsvdrfpasdvnpdhanheaalfgfypq
    kglfeeyaafgrghghdlapfdtyhevrglhwpvvegeetrwryregfdpyvkpgeglrf
    ygkpdgravilgvpyeppaespdeefgfwlvtgrvlehwhsgsmtlrwpelykafpgavc
    fmhpedarsrglnrgsevrvisrrgeirtrletrgrnrmprgvvfvpwfdasqlinkvtl
    dandpisrqtdfkkcavkieav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ogyO (O:)
    irwskapcrfcgtgcgvmvgtrdgqvvathgdtqaevnrglncvkgyflskimygedrlt
    tpllrmkdgvyhkegefapvswdeafdvmaaqaklvlkekapeavgmfgsgqwtiwegya
    asklmragfrsnnldpnarhcmasaatafmrtfgmdepmgcyddfeaadafvlwgsnmae
    mhpilwsrltdrrlshehvrvavlstfthrssdlsdtpiifrpgtdrailnyiahhiist
    grvnrdfvdrhtnfalgatdigyglrpehqlqlaakgaadagamtptdfetfaalvseyt
    lekaaeisgvepalleelaelyadpdrkwmslwtmgfnqhvrgvwanhmvynlhlltgki
    sepgnspfsltgqpfacgtarevgtfahrlpadmvvtnpehrahaeeiwklpagllpdwv
    gahaveqdrklhdgeinfywvqvnnnmqaapnidqetypgyrnpenfivvsdayptvtgr
    aadlvlpaamwvekegaygnaerrthfwhqlveapgearsdlwqlmefskrfttdevwpe
    eilsaapayrgktlfevlfangsvdrfpasdvnpdhanheaalfgfypqkglfeeyaafg
    rghghdlapfdtyhevrglhwpvvegeetrwryregfdpyvkpgeglrfygkpdgravil
    gvpyeppaespdeefgfwlvtgrvlehwhsgsmtlrwpelykafpgavcfmhpedarsrg
    lnrgsevrvisrrgeirtrletrgrnrmprgvvfvpwfdasqlinkvtldandpisrqtd
    fkkcavkiea
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >1ogyP (P:)
    qdaprltgadrpmsevaapplpetitddrrvgrnypeqppviphsiegyqlsvnanrcle
    chrrqysglvaapmisithfqdregqmladvsprryfctachvpqtnaqplvtnefrdml
    tlmpasneae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ogyP (P:)
    daprltgadrpmsevaapplpetitddrrvgrnypeqppviphsiegyqlsvnanrclec
    hrrqysglvaapmisithfqdregqmladvsprryfctachvpqtnaqplvtnefrdmlt
    lmpasne