PDB entry 1ogo

View 1ogo on RCSB PDB site
Description: dex49a from penicillium minioluteum complex with isomaltose
Deposited on 2003-05-08, released 2003-09-11
The last revision prior to the SCOP 1.67 freeze date was dated 2003-09-11, with a file datestamp of 2003-09-11.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.1882
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1ogoX (X:)
    hgttanthcgadfctwwhdsgeintqtpvqpgnvrqshkysvqvslagtnnfhdsfvyes
    iprngngriyaptdppnsntldssvddgisiepsiglnmawsqfeyshdvdvkilatdgs
    slgspsdvvirpvsisyaisqsddggivirvpadangrkfsvefktdlytflsdgneyvt
    sggsvvgveptnalvifaspflpsgmiphmtpdntqtmtpgpinngdwgaksilyfppgv
    ywmnqdqsgnsgklgsnhirlnsntywvylapgayvkgaieyftkqnfyatghgilsgen
    yvyqanagdnyiavksdstslrmwwhnnlgggqtwycvgptinappfntmdfngnsgiss
    qisdykqvgafffqtdgpeiypnsvvhdvfwhvnddaikiyysgasvsratiwkchndpi
    iqmgwtsrdisgvtidtlnvihtryiksetvvpsaiigaspfyasgmspdsrksismtvs
    nvvceglcpslfritplqnyknfvvknvafpdglqtnsigtgesiipaasgltmglaisa
    wtiggqkvtmenfqanslgqfnidgsywgewqis
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ogoX (X:)
    ttanthcgadfctwwhdsgeintqtpvqpgnvrqshkysvqvslagtnnfhdsfvyesip
    rngngriyaptdppnsntldssvddgisiepsiglnmawsqfeyshdvdvkilatdgssl
    gspsdvvirpvsisyaisqsddggivirvpadangrkfsvefktdlytflsdgneyvtsg
    gsvvgveptnalvifaspflpsgmiphmtpdntqtmtpgpinngdwgaksilyfppgvyw
    mnqdqsgnsgklgsnhirlnsntywvylapgayvkgaieyftkqnfyatghgilsgenyv
    yqanagdnyiavksdstslrmwwhnnlgggqtwycvgptinappfntmdfngnsgissqi
    sdykqvgafffqtdgpeiypnsvvhdvfwhvnddaikiyysgasvsratiwkchndpiiq
    mgwtsrdisgvtidtlnvihtryiksetvvpsaiigaspfyasgmspdsrksismtvsnv
    vceglcpslfritplqnyknfvvknvafpdglqtnsigtgesiipaasgltmglaisawt
    iggqkvtmenfqanslgqfnidgsywgewqis