PDB entry 1ogo

View 1ogo on RCSB PDB site
Description: Dex49A from Penicillium minioluteum complex with isomaltose
Class: hydrolase
Keywords: hydrolase, dextran degradation, glycosidase
Deposited on 2003-05-08, released 2003-09-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.6500000000000001 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: dextranase
    Species: PENICILLIUM MINIOLUTEUM [TaxId:28574]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P48845 (Start-573)
      • engineered mutation (4)
      • engineered mutation (536)
      • engineered mutation (539)
      • engineered mutation (542)
    Domains in SCOPe 2.08: d1ogox1, d1ogox2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1ogoX (X:)
    hgttanthcgadfctwwhdsgeintqtpvqpgnvrqshkysvqvslagtnnfhdsfvyes
    iprngngriyaptdppnsntldssvddgisiepsiglnmawsqfeyshdvdvkilatdgs
    slgspsdvvirpvsisyaisqsddggivirvpadangrkfsvefktdlytflsdgneyvt
    sggsvvgveptnalvifaspflpsgmiphmtpdntqtmtpgpinngdwgaksilyfppgv
    ywmnqdqsgnsgklgsnhirlnsntywvylapgayvkgaieyftkqnfyatghgilsgen
    yvyqanagdnyiavksdstslrmwwhnnlgggqtwycvgptinappfntmdfngnsgiss
    qisdykqvgafffqtdgpeiypnsvvhdvfwhvnddaikiyysgasvsratiwkchndpi
    iqmgwtsrdisgvtidtlnvihtryiksetvvpsaiigaspfyasgmspdsrksismtvs
    nvvceglcpslfritplqnyknfvvknvafpdglqtnsigtgesiipaasgltmglaisa
    wtiggqkvtmenfqanslgqfnidgsywgewqis
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ogoX (X:)
    ttanthcgadfctwwhdsgeintqtpvqpgnvrqshkysvqvslagtnnfhdsfvyesip
    rngngriyaptdppnsntldssvddgisiepsiglnmawsqfeyshdvdvkilatdgssl
    gspsdvvirpvsisyaisqsddggivirvpadangrkfsvefktdlytflsdgneyvtsg
    gsvvgveptnalvifaspflpsgmiphmtpdntqtmtpgpinngdwgaksilyfppgvyw
    mnqdqsgnsgklgsnhirlnsntywvylapgayvkgaieyftkqnfyatghgilsgenyv
    yqanagdnyiavksdstslrmwwhnnlgggqtwycvgptinappfntmdfngnsgissqi
    sdykqvgafffqtdgpeiypnsvvhdvfwhvnddaikiyysgasvsratiwkchndpiiq
    mgwtsrdisgvtidtlnvihtryiksetvvpsaiigaspfyasgmspdsrksismtvsnv
    vceglcpslfritplqnyknfvvknvafpdglqtnsigtgesiipaasgltmglaisawt
    iggqkvtmenfqanslgqfnidgsywgewqis