PDB entry 1ogm

View 1ogm on RCSB PDB site
Description: dex49a from penicillium minioluteum
Class: hydrolase
Keywords: hydrolase, dextran degradation, glycosidase
Deposited on 2003-05-07, released 2003-09-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.142
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: dextranase
    Species: PENICILLIUM MINIOLUTEUM [TaxId:28574]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P48845 (Start-573)
      • engineered mutation (4)
      • engineered mutation (536)
      • engineered mutation (539)
      • engineered mutation (542)
    Domains in SCOPe 2.07: d1ogmx1, d1ogmx2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1ogmX (X:)
    hgttanthcgadfctwwhdsgeintqtpvqpgnvrqshkysvqvslagtnnfhdsfvyes
    iprngngriyaptdppnsntldssvddgisiepsiglnmawsqfeyshdvdvkilatdgs
    slgspsdvvirpvsisyaisqsddggivirvpadangrkfsvefktdlytflsdgneyvt
    sggsvvgveptnalvifaspflpsgmiphmtpdntqtmtpgpinngdwgaksilyfppgv
    ywmnqdqsgnsgklgsnhirlnsntywvylapgayvkgaieyftkqnfyatghgilsgen
    yvyqanagdnyiavksdstslrmwwhnnlgggqtwycvgptinappfntmdfngnsgiss
    qisdykqvgafffqtdgpeiypnsvvhdvfwhvnddaikiyysgasvsratiwkchndpi
    iqmgwtsrdisgvtidtlnvihtryiksetvvpsaiigaspfyasgmspdsrksismtvs
    nvvceglcpslfritplqnyknfvvknvafpdglqtnsigtgesiipaasgltmglaisa
    wtiggqkvtmenfqanslgqfnidgsywgewqis
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ogmX (X:)
    ttanthcgadfctwwhdsgeintqtpvqpgnvrqshkysvqvslagtnnfhdsfvyesip
    rngngriyaptdppnsntldssvddgisiepsiglnmawsqfeyshdvdvkilatdgssl
    gspsdvvirpvsisyaisqsddggivirvpadangrkfsvefktdlytflsdgneyvtsg
    gsvvgveptnalvifaspflpsgmiphmtpdntqtmtpgpinngdwgaksilyfppgvyw
    mnqdqsgnsgklgsnhirlnsntywvylapgayvkgaieyftkqnfyatghgilsgenyv
    yqanagdnyiavksdstslrmwwhnnlgggqtwycvgptinappfntmdfngnsgissqi
    sdykqvgafffqtdgpeiypnsvvhdvfwhvnddaikiyysgasvsratiwkchndpiiq
    mgwtsrdisgvtidtlnvihtryiksetvvpsaiigaspfyasgmspdsrksismtvsnv
    vceglcpslfritplqnyknfvvknvafpdglqtnsigtgesiipaasgltmglaisawt
    iggqkvtmenfqanslgqfnidgsywgewqis