PDB entry 1ogl

View 1ogl on RCSB PDB site
Description: the crystal structure of native trypanosoma cruzi dutpase
Class: hydrolase
Keywords: hydrolase, dutpase, trypanosoma cruzi, native, x-ray, dimer
Deposited on 2003-05-07, released 2004-01-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.206
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: deoxyuridine triphosphatase
    Species: Trypanosoma cruzi [TaxId:5693]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ogla_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oglA (A:)
    mnrvqsgfrvparvlnslahlqdglnifmdpdwrqirhvddwalaitmesaelidsypwk
    wwknvkaqtdmhnvrieiadilhfslsgeiqkrtqdekgaddvalkslkemgffcrppah
    akstaasgqrtnggdgdgddellelmffpltevasavatfrniiqlasiyrfdlitkgll
    laaqdldfnlvgyyvakytlnqirqlkgykegvyvkvregvednellhecvqsvsvedvl
    negtylkawekiacsvfdafgmpeeerrhaydwlksaaldgkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oglA (A:)
    rvparvlnslahlqdglnifmdpdwrqirhvddwalaitmesaelidsypwkwwknvkaq
    tdmhnvrieiadilhfslsgeiqkrtqdddvalkslkemgffcrppadellelmffplte
    vasavatfrniiqlasiyrfdlitkglllaaqdldfnlvgyyvakytlnqirqlkgykeg
    vyvkvregvednellhecvqsvsvedvlnegtylkawekiacsvfdafgmpeeerrhayd
    wlksaa