PDB entry 1ogk

View 1ogk on RCSB PDB site
Description: the crystal structure of trypanosoma cruzi dutpase in complex with dudp
Class: hydrolase
Keywords: dimer, hydrolase
Deposited on 2003-05-07, released 2004-01-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.209
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: deoxyuridine triphosphatase
    Species: Trypanosoma cruzi [TaxId:5693]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ogka_
  • Chain 'B':
    Compound: deoxyuridine triphosphatase
    Species: Trypanosoma cruzi [TaxId:5693]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ogkb_
  • Chain 'D':
    Compound: deoxyuridine triphosphatase
    Species: Trypanosoma cruzi [TaxId:5693]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ogkd_
  • Chain 'E':
    Compound: deoxyuridine triphosphatase
    Species: Trypanosoma cruzi [TaxId:5693]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ogke_
  • Heterogens: DUD

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ogkA (A:)
    mnrvqsgfrvparvlnslahlqdglnifmdpdwrqirhvddwalaitmesaelidsypwk
    wwknvkaqtdmhnvrieiadilhfslsgeiqkrtqdekgaddvalkslkemgffcrppah
    akstaasgqrtnggdgdgddellelmffpltevasavatfrniiqlasiyrfdlitkgll
    laaqdldfnlvgyyvakytlnqirqlkgykegvyvkvregvednellhecvqsvsvedvl
    negtylkawekiacsvfdafgmpeeerrhaydwlksaaldgkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ogkA (A:)
    vparvlnslahlqdglnifmdpdwrqirhvddwalaitmesaelidsypwkwwknvkaqt
    dmhnvrieiadilhfslsgeiqkrddvalkslkemgffcrppaddellelmffpltevas
    avatfrniiqlasiyrfdlitkglllaaqdldfnlvgyyvakytlnqirqlednellhec
    vqsvsvedvlnegtylkawekiacsvfdafgmpeeerrhaydwlksaald
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ogkB (B:)
    mnrvqsgfrvparvlnslahlqdglnifmdpdwrqirhvddwalaitmesaelidsypwk
    wwknvkaqtdmhnvrieiadilhfslsgeiqkrtqdekgaddvalkslkemgffcrppah
    akstaasgqrtnggdgdgddellelmffpltevasavatfrniiqlasiyrfdlitkgll
    laaqdldfnlvgyyvakytlnqirqlkgykegvyvkvregvednellhecvqsvsvedvl
    negtylkawekiacsvfdafgmpeeerrhaydwlksaaldgkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ogkB (B:)
    parvlnslahlqdglnifmdpdwrqirhvddwalaitmesaelidsypwkwwknvkaqtd
    mhnvrieiadilhfslsgeiqkrdvalkslkemgffcrppdellelmffpltevasavat
    frniiqlasiyrfdlitkglllaaqdldfnlvgyyvakytlnqirqlkgykegvyvkvre
    gvednellhecvqsvsvedvlnegtylkawekiacsvfdafgmpeeerrhaydwlksaal
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ogkD (D:)
    mnrvqsgfrvparvlnslahlqdglnifmdpdwrqirhvddwalaitmesaelidsypwk
    wwknvkaqtdmhnvrieiadilhfslsgeiqkrtqdekgaddvalkslkemgffcrppah
    akstaasgqrtnggdgdgddellelmffpltevasavatfrniiqlasiyrfdlitkgll
    laaqdldfnlvgyyvakytlnqirqlkgykegvyvkvregvednellhecvqsvsvedvl
    negtylkawekiacsvfdafgmpeeerrhaydwlksaaldgkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ogkD (D:)
    parvlnslahlqdglnifmdpdwrqirhvddwalaitmesaelidsypwkwwknvkaqtd
    mhnvrieiadilhfslsgeiqkralkslkemgffcrppdellelmffpltevasavatfr
    niiqlasiyrfdlitkglllaaqdldfnlvgyyvakytlnqirqlkgykegvyvkvregv
    ednellhecvqsvsvedvlnegtylkawekiacsvfdafgmpeeerrhaydwlksaal
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1ogkE (E:)
    mnrvqsgfrvparvlnslahlqdglnifmdpdwrqirhvddwalaitmesaelidsypwk
    wwknvkaqtdmhnvrieiadilhfslsgeiqkrtqdekgaddvalkslkemgffcrppah
    akstaasgqrtnggdgdgddellelmffpltevasavatfrniiqlasiyrfdlitkgll
    laaqdldfnlvgyyvakytlnqirqlkgykegvyvkvregvednellhecvqsvsvedvl
    negtylkawekiacsvfdafgmpeeerrhaydwlksaaldgkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ogkE (E:)
    vparvlnslahlqdglnifmdpdwrqirhvddwalaitmesaelidsypwkwwknvkaqt
    dmhnvrieiadilhfslsgeiqkrdvalkslkemgffcrppdellelmffpltevasava
    tfrniiqlasiyrfdlitkglllaaqdldfnlvgyyvakytlnqirqlkgykegvyvkvr
    egvednellhecvqsvsvedvlnegtylkawekiacsvfdafgmpeeerrhaydwlksaa
    ld