PDB entry 1ogj

View 1ogj on RCSB PDB site
Description: ferredoxin:nadp+ reductase mutant with leu 263 replaced by pro (l263p)
Class: oxidoreductase
Keywords: oxidoreductase, flavoprotein, nadp, fad, fnr, nadp reductase
Deposited on 2003-05-06, released 2003-09-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-09-16, with a file datestamp of 2015-09-11.
Experiment type: XRAY
Resolution: 1.64 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferredoxin--nadp+ reductase
    Species: ANABAENA SP. (STRAIN PCC 7119) [TaxId:1168]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21890 (Start-302)
      • conflict (245)
      • engineered mutation (262)
    Domains in SCOPe 2.06: d1ogja1, d1ogja2
  • Heterogens: FAD, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ogjA (A:)
    tqakakhadvpvnlyrpnapfigkvisneplvkeggigivqhikfdltggnlkyiegqsi
    giippgvdkngkpeklrlysiastrhgddvddktislcvrqleykhpesgetvygvcsty
    lthiepgsevkitgpvgkemllpddpeanvimlatgtgiapmrtylwrmfkdaeraanpe
    yqfkgfswlvfgvpttpnilykeeleeiqqkypdnfrltyaisreqknpqggrmyiqdrv
    aehadqlwqliknqkthtyicgprgmeegidaalsaaaakegvtwsdyqkdlkkagrwhv
    ety
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ogjA (A:)
    dvpvnlyrpnapfigkvisneplvkeggigivqhikfdltggnlkyiegqsigiippgvd
    kngkpeklrlysiastrhgddvddktislcvrqleykhpesgetvygvcstylthiepgs
    evkitgpvgkemllpddpeanvimlatgtgiapmrtylwrmfkdaeraanpeyqfkgfsw
    lvfgvpttpnilykeeleeiqqkypdnfrltyaisreqknpqggrmyiqdrvaehadqlw
    qliknqkthtyicgprgmeegidaalsaaaakegvtwsdyqkdlkkagrwhvety