PDB entry 1ogh

View 1ogh on RCSB PDB site
Description: structure of the bifunctional dctp deaminase-dutpase from methanocaldococcus jannaschii
Deposited on 2003-05-02, released 2003-06-05
The last revision prior to the SCOP 1.65 freeze date was dated 2003-07-24, with a file datestamp of 2003-07-24.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: 0.14842
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1ogha_
  • Chain 'B':
    Domains in SCOP 1.65: d1oghb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oghA (A:)
    milsdkdiidyvtskriiikpfnkdfvgpcsydvtlgdefiiyddevydlskelnykrik
    iknsilvcplnynlteekinyfkekynvdyvveggvlgttneyielpndisaqyqgrssl
    grvfltshqtagwidagfkgkitleivafdkpvilyknqrigqlifskllspadvgyser
    ktskyayqksvmpslihldnhkkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oghA (A:)
    milsdkdiidyvtskriiikpfnkdfvgpcsydvtlgdefiiyddevydlskelnykrik
    iknsilvcplnynlteekinyfkekynvdyvveggvlgttneyielpndisaqyqgrssl
    grvfltshqtagwidagfkgkitleivafdkpvilyknqrigqlifskllspadv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1oghB (B:)
    milsdkdiidyvtskriiikpfnkdfvgpcsydvtlgdefiiyddevydlskelnykrik
    iknsilvcplnynlteekinyfkekynvdyvveggvlgttneyielpndisaqyqgrssl
    grvfltshqtagwidagfkgkitleivafdkpvilyknqrigqlifskllspadvgyser
    ktskyayqksvmpslihldnhkkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oghB (B:)
    milsdkdiidyvtskriiikpfnkdfvgpcsydvtlgdefiiyddevydlskelnykrik
    iknsilvcplnynlteekinyfkekynvdyvveggvlgttneyielpndisaqyqgrssl
    grvfltshqtagwidagfkgkitleivafdkpvilyknqrigqlifskllspadvgyser
    k