PDB entry 1ogg

View 1ogg on RCSB PDB site
Description: chitinase b from serratia marcescens mutant d142n in complex with inhibitor allosamidin
Class: hydrolase
Keywords: hydrolase, chitin degradation, glycoside hydrolase
Deposited on 2003-04-30, released 2004-04-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.97 Å
R-factor: 0.198
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chitinase b
    Species: SERRATIA MARCESCENS [TaxId:615]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11797 (Start-498)
      • engineered mutation (141)
      • conflict (497)
    Domains in SCOPe 2.07: d1ogga1, d1ogga2, d1ogga3
  • Chain 'B':
    Compound: chitinase b
    Species: SERRATIA MARCESCENS [TaxId:615]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11797 (Start-498)
      • engineered mutation (141)
      • conflict (497)
    Domains in SCOPe 2.07: d1oggb1, d1oggb2, d1oggb3
  • Heterogens: AMI, GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oggA (A:)
    mstrkavigyyfiptnqinnytetdtsvvpfpvsnitpakakqlthinfsfldinsnlec
    awdpatndakardvvnrltalkahnpslrimfsiggwyysndlgvshanyvnavktpasr
    akfaqscvrimkdygfdgvdinweypqaaevdgfiaalqeirtllnqqtitdgrqalpyq
    ltiagaggafflsryysklaqivapldyinlmtydlagpwekvtnhqaalfgdaagptfy
    nalreanlgwsweeltrafpspfsltvdaavqqhlmmegvpsakivmgvpfygrafkgvs
    ggnggqysshstpgedpypstdywlvgceecvrdkdpriasyrqleqmlqgnygyqrlwn
    dktktpylyhaqnglfvtyddaesfkykakyikqqqlggvmfwhlgqdnrngdllaaldr
    yfnaadyddsqldmgtglrytgvgpgnlpimtapayvpgttyaqgalvsyqgyvwqtkwg
    yitsapgsdsawlkvgrva
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oggA (A:)
    trkavigyyfiptnqinnytetdtsvvpfpvsnitpakakqlthinfsfldinsnlecaw
    dpatndakardvvnrltalkahnpslrimfsiggwyysndlgvshanyvnavktpasrak
    faqscvrimkdygfdgvdinweypqaaevdgfiaalqeirtllnqqtitdgrqalpyqlt
    iagaggafflsryysklaqivapldyinlmtydlagpwekvtnhqaalfgdaagptfyna
    lreanlgwsweeltrafpspfsltvdaavqqhlmmegvpsakivmgvpfygrafkgvsgg
    nggqysshstpgedpypstdywlvgceecvrdkdpriasyrqleqmlqgnygyqrlwndk
    tktpylyhaqnglfvtyddaesfkykakyikqqqlggvmfwhlgqdnrngdllaaldryf
    naadyddsqldmgtglrytgvgpgnlpimtapayvpgttyaqgalvsyqgyvwqtkwgyi
    tsapgsdsawlkvgrva
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1oggB (B:)
    mstrkavigyyfiptnqinnytetdtsvvpfpvsnitpakakqlthinfsfldinsnlec
    awdpatndakardvvnrltalkahnpslrimfsiggwyysndlgvshanyvnavktpasr
    akfaqscvrimkdygfdgvdinweypqaaevdgfiaalqeirtllnqqtitdgrqalpyq
    ltiagaggafflsryysklaqivapldyinlmtydlagpwekvtnhqaalfgdaagptfy
    nalreanlgwsweeltrafpspfsltvdaavqqhlmmegvpsakivmgvpfygrafkgvs
    ggnggqysshstpgedpypstdywlvgceecvrdkdpriasyrqleqmlqgnygyqrlwn
    dktktpylyhaqnglfvtyddaesfkykakyikqqqlggvmfwhlgqdnrngdllaaldr
    yfnaadyddsqldmgtglrytgvgpgnlpimtapayvpgttyaqgalvsyqgyvwqtkwg
    yitsapgsdsawlkvgrva
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oggB (B:)
    trkavigyyfiptnqinnytetdtsvvpfpvsnitpakakqlthinfsfldinsnlecaw
    dpatndakardvvnrltalkahnpslrimfsiggwyysndlgvshanyvnavktpasrak
    faqscvrimkdygfdgvdinweypqaaevdgfiaalqeirtllnqqtitdgrqalpyqlt
    iagaggafflsryysklaqivapldyinlmtydlagpwekvtnhqaalfgdaagptfyna
    lreanlgwsweeltrafpspfsltvdaavqqhlmmegvpsakivmgvpfygrafkgvsgg
    nggqysshstpgedpypstdywlvgceecvrdkdpriasyrqleqmlqgnygyqrlwndk
    tktpylyhaqnglfvtyddaesfkykakyikqqqlggvmfwhlgqdnrngdllaaldryf
    naadyddsqldmgtglrytgvgpgnlpimtapayvpgttyaqgalvsyqgyvwqtkwgyi
    tsapgsdsawlkvgrva