PDB entry 1ofv

View 1ofv on RCSB PDB site
Description: flavodoxin from anacystis nidulans: refinement of two forms of the oxidized protein
Class: electron transport
Keywords: electron transport
Deposited on 1992-06-22, released 1994-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: flavodoxin
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:269084]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ofva_
  • Heterogens: FMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ofvA (A:)
    akiglfygtqtgvtqtiaesiqqefggesivdlndianadasdlnaydyliigcptwnvg
    elqsdwegiyddldsvnfqgkkvayfgagdqvgysdnfqdamgileekisslgsqtvgyw
    piegydfneskavrnnqfvglaidednqpdltknriktwvsqlksefgl