PDB entry 1ofu

View 1ofu on RCSB PDB site
Description: crystal structure of sula:ftsz from pseudomonas aeruginosa
Class: bacterial cell division inhibitor
Keywords: bacterial cell division inhibitor, ftsz, sula protein
Deposited on 2003-04-21, released 2003-06-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.2159
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cell division protein ftsz
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ofua1, d1ofua2
  • Chain 'B':
    Compound: cell division protein ftsz
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ofub1, d1ofub2
  • Chain 'X':
    Compound: hypothetical protein pa3008
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ofux_
  • Chain 'Y':
    Compound: hypothetical protein pa3008
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ofuy_
  • Heterogens: GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ofuA (A:)
    mfelvdniaqtavikvigvgggggnavnhmaknnvegveficantdaqalkniaartvlq
    lgpgvtkglgaganpevgrqaaledrerisevlegadmvfittgmgggtgtgaapiiaev
    akemgiltvavvtrpfpfegrkrmqiadegiralaesvdslitipneklltilgkdasll
    aafakaddvlagavrgisdiikrpgminvdfadvktvmsemgmammgtgcasgpnrarea
    teaairnplledvnlqgargilvnitagpdlslgeysdvgniieqfasehatvkvgtvid
    admrdelhvtvvatglgarl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ofuA (A:)
    tavikvigvgggggnavnhmaknnvegveficantdaqalkniaartvlqlgpgvtkglg
    aganpevgrqaaledrerisevlegadmvfittgmgggtgtgaapiiaevakemgiltva
    vvtrpfpfegrkrmqiadegiralaesvdslitipneklltilgkdasllaafakaddvl
    agavrgisdiikrpgminvdfadvktvmsemgmammgtgcasgpnrareateaairnpll
    edvnlqgargilvnitagpdlslgeysdvgniieqfasehatvkvgtvidadmrdelhvt
    vvatglg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ofuB (B:)
    mfelvdniaqtavikvigvgggggnavnhmaknnvegveficantdaqalkniaartvlq
    lgpgvtkglgaganpevgrqaaledrerisevlegadmvfittgmgggtgtgaapiiaev
    akemgiltvavvtrpfpfegrkrmqiadegiralaesvdslitipneklltilgkdasll
    aafakaddvlagavrgisdiikrpgminvdfadvktvmsemgmammgtgcasgpnrarea
    teaairnplledvnlqgargilvnitagpdlslgeysdvgniieqfasehatvkvgtvid
    admrdelhvtvvatglgarl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ofuB (B:)
    tavikvigvgggggnavnhmaknnvegveficantdaqalkniaartvlqlgpgvtkglg
    aganpevgrqaaledrerisevlegadmvfittgmgggtgtgaapiiaevakemgiltva
    vvtrpfpfegrkrmqiadegiralaesvdslitipneklltilgkdasllaafakaddvl
    agavrgisdiikrpgminvdfadvktvmsemgmammgtgcasgpnrareateaairnpll
    edvnlqgargilvnitagpdlslgeysdvgniieqfasehatvkvgtvidadmrdelhvt
    vvatglg
    

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ofuX (X:)
    paafselslsglpghcltllapilrelseeqdarwltliappaslthewlrraglnreri
    lllqakdnaaalalscealrlgrshtvvswleplsraarkqlsraaqlgqaqslnirlg
    

  • Chain 'Y':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ofuY (Y:)
    paafselslsglpghcltllapilrelseeqdarwltliappaslthewlrraglnreri
    lllqakdnaaalalscealrlgrshtvvswleplsraarkqlsraaqlgqaqslnirlg