PDB entry 1ofs

View 1ofs on RCSB PDB site
Description: pea lectin-sucrose complex
Class: lectin
Keywords: plant lectin, carbohydrate binding protein,calcium, glycoprotein
Deposited on 2003-04-19, released 2003-06-19
The last revision prior to the SCOP 1.73 freeze date was dated 2003-06-19, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.168
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pea lectin alpha chain
    Species: Pisum sativum
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1ofs.1
  • Chain 'B':
    Compound: pea lectin beta chain
    Species: Pisum sativum
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1ofs.1
  • Chain 'C':
    Compound: pea lectin alpha chain
    Species: Pisum sativum
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1ofs.2
  • Chain 'D':
    Compound: pea lectin beta chain
    Species: Pisum sativum
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1ofs.2
  • Heterogens: SUC, MN, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ofsA (A:)
    tettsflitkfspdqqnlifqgdgyttkekltltkavkntvgralysspihiwdretgnv
    anfvtsftfvinapnsynvadgftffiapvdtkpqtgggylgvfnsaeydkttqtvavef
    dtfynaawdpsnrdrhigidvnsiksvntkswklqngeeanvviafnaatnvltvsltyp
    nsleeen
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ofsA (A:)
    tettsflitkfspdqqnlifqgdgyttkekltltkavkntvgralysspihiwdretgnv
    anfvtsftfvinapnsynvadgftffiapvdtkpqtgggylgvfnsaeydkttqtvavef
    dtfynaawdpsnrdrhigidvnsiksvntkswklqngeeanvviafnaatnvltvsltyp
    ns
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ofsB (B:)
    vtsytlsdvvslkdvvpewvrigfsattgaeyaahevlswsfhselsg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ofsC (C:)
    tettsflitkfspdqqnlifqgdgyttkekltltkavkntvgralysspihiwdretgnv
    anfvtsftfvinapnsynvadgftffiapvdtkpqtgggylgvfnsaeydkttqtvavef
    dtfynaawdpsnrdrhigidvnsiksvntkswklqngeeanvviafnaatnvltvsltyp
    nsleeen
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ofsC (C:)
    tettsflitkfspdqqnlifqgdgyttkekltltkavkntvgralysspihiwdretgnv
    anfvtsftfvinapnsynvadgftffiapvdtkpqtgggylgvfnsaeydkttqtvavef
    dtfynaawdpsnrdrhigidvnsiksvntkswklqngeeanvviafnaatnvltvsltyp
    ns
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ofsD (D:)
    vtsytlsdvvslkdvvpewvrigfsattgaeyaahevlswsfhselsg