PDB entry 1ofp

View 1ofp on RCSB PDB site
Description: crystal structure of the tyrosine-regulated 3-deoxy-d-arabino-heptulosonate-7-phosphate synthase from saccharomyces cerevisiae
Class: lyase
Keywords: beta-alpha-barrel, lyase, aromatic amino-acid biosynthesis
Deposited on 2003-04-17, released 2004-04-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.205
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospho-2-dehydro-3-deoxyheptonate aldolase
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ofpa_
  • Chain 'B':
    Compound: phospho-2-dehydro-3-deoxyheptonate aldolase
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ofpb_
  • Chain 'C':
    Compound: phospho-2-dehydro-3-deoxyheptonate aldolase
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ofpc_
  • Chain 'D':
    Compound: phospho-2-dehydro-3-deoxyheptonate aldolase
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ofpd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ofpA (A:)
    msespmfaangmpkvnqgaeedvrilgydplaspallqvqipatptsletakrgrreaid
    iitgkddrvlvivgpcsihdleaaqeyalrlkklsdelkgdlsiimraylekprttvgwk
    glindpdvnntfninkglqsarqlfvnltniglpigsemldtispqyladlvsfgaigar
    ttesqlhrelasglsfpvgfkngtdgtlnvavdacqaaahshhfmgvtkhgvaaitttkg
    nehcfvilrggkkgtnydaksvaeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvc
    eqiangenaitgvmiesninegnqgipaegkaglkygvsitdacigwettedvlrklaaa
    vrqrrevnkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ofpA (A:)
    edvrilgydplaspallqvqipatptsletakrgrreaidiitgkddrvlvivgpcsihd
    leaaqeyalrlkklsdelkgdlsiimraylglindpdvnntfninkglqsarqlfvnltn
    iglpigsemldtispqyladlvsfgaigarttesqlhrelasglsfpvgfknlnvavdac
    qaaahshhfmgvtkhgvaaitttkgnehcfvilrydaksvaeakaqlpagsnglmidyfr
    nqpkvndvvceqiangenaitgvmiesninegkygvsitdacigwettedvlrklaaavr
    qrrevnk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ofpB (B:)
    msespmfaangmpkvnqgaeedvrilgydplaspallqvqipatptsletakrgrreaid
    iitgkddrvlvivgpcsihdleaaqeyalrlkklsdelkgdlsiimraylekprttvgwk
    glindpdvnntfninkglqsarqlfvnltniglpigsemldtispqyladlvsfgaigar
    ttesqlhrelasglsfpvgfkngtdgtlnvavdacqaaahshhfmgvtkhgvaaitttkg
    nehcfvilrggkkgtnydaksvaeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvc
    eqiangenaitgvmiesninegnqgipaegkaglkygvsitdacigwettedvlrklaaa
    vrqrrevnkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ofpB (B:)
    edvrilgydplaspallqvqipatptsletakrgrreaidiitgkddrvlvivgpcsihd
    leaaqeyalrlkklsdelkgdlsiimraylekpwkglindpdvnntfninkglqsarqlf
    vnltniglpigsemldtispqyladlvsfgaigarttesqlhrelasglsfpvgfkntln
    vavdacqaaahshhfmgvtkhgvaaitttkgnehcfvilrgtnydaksvaeakaqlpags
    nglmidysfrnqpkvndvvceqiangenaitgvmiesninegnqgikygvsitdacigwe
    ttedvlrklaaavrqrrevnkk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ofpC (C:)
    msespmfaangmpkvnqgaeedvrilgydplaspallqvqipatptsletakrgrreaid
    iitgkddrvlvivgpcsihdleaaqeyalrlkklsdelkgdlsiimraylekprttvgwk
    glindpdvnntfninkglqsarqlfvnltniglpigsemldtispqyladlvsfgaigar
    ttesqlhrelasglsfpvgfkngtdgtlnvavdacqaaahshhfmgvtkhgvaaitttkg
    nehcfvilrggkkgtnydaksvaeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvc
    eqiangenaitgvmiesninegnqgipaegkaglkygvsitdacigwettedvlrklaaa
    vrqrrevnkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ofpC (C:)
    edvrilgydplaspallqvqipatptsletakrgrreaidiitgkddrvlvivgpcsihd
    leaaqeyalrlkklsdelkgdlsiimraylewkglindpdvnntfninkglqsarqlfvn
    ltniglpigsemldtispqyladlvsfgaigarttesqlhrelasglsfpvgfknlnvav
    dacqaaahshhfmgvtkhgvaaitttkgnehcfvilrgtnydaksvaeakaqlpagsngl
    midysfrnqpkvndvvceqiangenaitgvmiesninegnqgikygvsitdacigwette
    dvlrklaaavrqrrevnkk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ofpD (D:)
    msespmfaangmpkvnqgaeedvrilgydplaspallqvqipatptsletakrgrreaid
    iitgkddrvlvivgpcsihdleaaqeyalrlkklsdelkgdlsiimraylekprttvgwk
    glindpdvnntfninkglqsarqlfvnltniglpigsemldtispqyladlvsfgaigar
    ttesqlhrelasglsfpvgfkngtdgtlnvavdacqaaahshhfmgvtkhgvaaitttkg
    nehcfvilrggkkgtnydaksvaeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvc
    eqiangenaitgvmiesninegnqgipaegkaglkygvsitdacigwettedvlrklaaa
    vrqrrevnkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ofpD (D:)
    eedvrilgydplaspallqvqipatptsletakrgrreaidiitgkddrvlvivgpcsih
    dleaaqeyalrlkklsdelkgdlsiimraylwkglindpdvntfninkglqsarqlfvnl
    tniglpigsemldtispqyladlvsfgaigarttesqlhrelasglsfpvgfknlnvavd
    acqaaahshhfmgvtkhgvaaitttkgnehcfvilrgnydaksvaeakaqlpagsnglmi
    dyfrnqpkvndvvceqiangenaitgvmiesninegnqgikygvsitdacigwettedvl
    rklaaavrqrrevnk