PDB entry 1ofn

View 1ofn on RCSB PDB site
Description: purification, crystallisation and preliminary structural studies of dtdp-4-keto-6-deoxy-glucose-5-epimerase (evad) from amycolatopsis orientalis; the fourth enzyme in the dtdp-l-epivancosamine biosynthetic pathway.
Deposited on 2003-04-17, released 2004-04-15
The last revision prior to the SCOP 1.71 freeze date was dated 2004-04-15, with a file datestamp of 2004-04-15.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.14607
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1ofna_
  • Chain 'B':
    Domains in SCOP 1.71: d1ofnb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ofnA (A:)
    mqarklavdgaieftprvfaddrgllilpyqeeafveahggplfrvaqtihsmskrgvvr
    gihytvtppgtakyvycargkamdividirvgsptfgqwdsvlmdqqdpravylpvgvgh
    afvaleddtvmsymlsrsyvtqdelalsaldpalglpidigvepivsdrdrvaitlaeaq
    rqgllpdyttsqeierrltavpvst
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ofnA (A:)
    mqarklavdgaieftprvfaddrgllilpyqeeafveahggplfrvaqtihsmskrgvvr
    gihytvtppgtakyvycargkamdividirvgsptfgqwdsvlmdqqdpravylpvgvgh
    afvaleddtvmsymlsrsyvtqdelalsaldpalglpidigvepivsdrdrvaitlaeaq
    rqgllpdyttsqeierrltavp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ofnB (B:)
    mqarklavdgaieftprvfaddrgllilpyqeeafveahggplfrvaqtihsmskrgvvr
    gihytvtppgtakyvycargkamdividirvgsptfgqwdsvlmdqqdpravylpvgvgh
    afvaleddtvmsymlsrsyvtqdelalsaldpalglpidigvepivsdrdrvaitlaeaq
    rqgllpdyttsqeierrltavpvst
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ofnB (B:)
    mqarklavdgaieftprvfaddrgllilpyqeeafveahggplfrvaqtihsmskrgvvr
    gihytvtppgtakyvycargkamdividirvgsptfgqwdsvlmdqqdpravylpvgvgh
    afvaleddtvmsymlsrsyvtqdelalsaldpalglpidigvepivsdrdrvaitlaeaq
    rqgllpdyttsqeierrltavpv