PDB entry 1ofk

View 1ofk on RCSB PDB site
Description: recombinant sperm whale myoglobin f43h, h64l mutant (met)
Class: oxygen transport
Keywords: heme, oxygen transport, muscle protein, peroxidase activity
Deposited on 1998-06-03, released 1998-11-11
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.153
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon [TaxId:9755]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02185 (1-153)
      • engineered (43)
      • engineered (64)
      • engineered (122)
    Domains in SCOPe 2.05: d1ofka_
  • Heterogens: SO4, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ofkA (A:)
    mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekhdrfkhlkteaemkase
    dlkklgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
    pgnfgadaqgamnkalelfrkdiaakykelgyqg