PDB entry 1ofk

View 1ofk on RCSB PDB site
Description: recombinant sperm whale myoglobin f43h, h64l mutant (met)
Deposited on 1998-06-03, released 1998-11-11
The last revision prior to the SCOP 1.55 freeze date was dated 1998-11-11, with a file datestamp of 1998-11-11.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.153
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1ofk__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ofk_ (-)
mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekhdrfkhlkteaemkase
dlkklgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
pgnfgadaqgamnkalelfrkdiaakykelgyqg