PDB entry 1ofj

View 1ofj on RCSB PDB site
Description: recombinant sperm whale myoglobin l29h/h64l/d122n mutant (with initiator met)
Class: oxygen transport
Keywords: heme, oxygen transport, muscle protein, peroxidase activity
Deposited on 1998-01-30, released 1998-05-27
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.162
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Myoglobin
  Species: Physeter catodon [TaxId:9755]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02185 (1-153)
    • engineered (29)
    • engineered (64)
    • engineered (122)
  Domains in SCOPe 2.01: d1ofja_
• Heterogens: SO4, HEM, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ofjA (A:)
  mvlsegewqlvlhvwakveadvaghgqdihirlfkshpetlekfdrfkhlkteaemkase
  dlkklgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
  pgnfgadaqgamnkalelfrkdiaakykelgyqg