PDB entry 1ofj

View 1ofj on RCSB PDB site
Description: recombinant sperm whale myoglobin l29h/h64l/d122n mutant (with initiator met)
Deposited on 1998-01-30, released 1998-05-27
The last revision prior to the SCOP 1.57 freeze date was dated 1998-05-27, with a file datestamp of 1998-05-27.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.162
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d1ofj__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ofj_ (-)
mvlsegewqlvlhvwakveadvaghgqdihirlfkshpetlekfdrfkhlkteaemkase
dlkklgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
pgnfgadaqgamnkalelfrkdiaakykelgyqg