PDB entry 1ofh

View 1ofh on RCSB PDB site
Description: asymmetric complex between hslv and I-domain deleted hslu (h. influenzae)
Class: hydrolase
Keywords: chaperone, hydrolase, ATP-binding
Deposited on 2003-04-14, released 2003-07-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.224
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent hsl protease ATP-binding subunit hslu
    Species: HAEMOPHILUS INFLUENZAE [TaxId:71421]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43773 (109-309)
    • PDB 1OFH (107-108)
    Domains in SCOPe 2.07: d1ofha_
  • Chain 'B':
    Compound: ATP-dependent hsl protease ATP-binding subunit hslu
    Species: HAEMOPHILUS INFLUENZAE [TaxId:71421]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43773 (109-309)
    • PDB 1OFH (107-108)
    Domains in SCOPe 2.07: d1ofhb_
  • Chain 'C':
    Compound: ATP-dependent hsl protease ATP-binding subunit hslu
    Species: HAEMOPHILUS INFLUENZAE [TaxId:71421]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43773 (109-309)
    • PDB 1OFH (107-108)
    Domains in SCOPe 2.07: d1ofhc_
  • Chain 'G':
    Compound: ATP-dependent protease hslv
    Species: HAEMOPHILUS INFLUENZAE [TaxId:71421]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ofhg_
  • Chain 'H':
    Compound: ATP-dependent protease hslv
    Species: HAEMOPHILUS INFLUENZAE [TaxId:71421]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ofhh_
  • Chain 'I':
    Compound: ATP-dependent protease hslv
    Species: HAEMOPHILUS INFLUENZAE [TaxId:71421]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ofhi_
  • Chain 'L':
    Compound: ATP-dependent protease hslv
    Species: HAEMOPHILUS INFLUENZAE [TaxId:71421]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ofhl_
  • Chain 'M':
    Compound: ATP-dependent protease hslv
    Species: HAEMOPHILUS INFLUENZAE [TaxId:71421]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ofhm_
  • Chain 'N':
    Compound: ATP-dependent protease hslv
    Species: HAEMOPHILUS INFLUENZAE [TaxId:71421]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ofhn_
  • Heterogens: ADP, MG, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ofhA (A:)
    msemtpreivseldqhiigqadakravaialrnrwrrmqlqeplrhevtpknilmigptg
    vgkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdsaggaidaveqngiv
    fideidkickkgeysgadvsregvqrdllplvegstvstkhgmvktdhilfiasgafqva
    rpsdlipelqgrlpirveltalsaadferiltephaslteqykalmategvniafttdav
    kkiaeaafrvnektenigarrlhtvmerlmdkisfsasdmngqtvnidaayvadalgevv
    enedlsrfil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ofhA (A:)
    semtpreivseldqhiigqadakravaialrnrwrrmqlqeplrhevtpknilmigptgv
    gkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdsaggaidaveqngivf
    ideidkickkgeysgadvsregvqrdllplvegstvstkhgmvktdhilfiasgafqvar
    psdlipelqgrlpirveltalsaadferiltephaslteqykalmategvniafttdavk
    kiaeaafrvnektenigarrlhtvmerlmdkisfsasdmngqtvnidaayvadalgevve
    nedlsrfil
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ofhB (B:)
    msemtpreivseldqhiigqadakravaialrnrwrrmqlqeplrhevtpknilmigptg
    vgkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdsaggaidaveqngiv
    fideidkickkgeysgadvsregvqrdllplvegstvstkhgmvktdhilfiasgafqva
    rpsdlipelqgrlpirveltalsaadferiltephaslteqykalmategvniafttdav
    kkiaeaafrvnektenigarrlhtvmerlmdkisfsasdmngqtvnidaayvadalgevv
    enedlsrfil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ofhB (B:)
    semtpreivseldqhiigqadakravaialrnrwrrmqlqeplrhevtpknilmigptgv
    gkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdsaggaidaveqngivf
    ideidkickkgeysgadvsregvqrdllplvegstvstkhgmvktdhilfiasgafqvar
    psdlipelqgrlpirveltalsaadferiltephaslteqykalmategvniafttdavk
    kiaeaafrvnektenigarrlhtvmerlmdkisfsasdmngqtvnidaayvadalgevve
    nedlsrfil
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ofhC (C:)
    msemtpreivseldqhiigqadakravaialrnrwrrmqlqeplrhevtpknilmigptg
    vgkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdsaggaidaveqngiv
    fideidkickkgeysgadvsregvqrdllplvegstvstkhgmvktdhilfiasgafqva
    rpsdlipelqgrlpirveltalsaadferiltephaslteqykalmategvniafttdav
    kkiaeaafrvnektenigarrlhtvmerlmdkisfsasdmngqtvnidaayvadalgevv
    enedlsrfil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ofhC (C:)
    semtpreivseldqhiigqadakravaialrnrwrrmqlqeplrhevtpknilmigptgv
    gkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdsaggaidaveqngivf
    ideidkickkgeysgadvsregvqrdllplvegstvstkhgmvktdhilfiasgafqvar
    psdlipelqgrlpirveltalsaadferiltephaslteqykalmategvniafttdavk
    kiaeaafrvnektenigarrlhtvmerlmdkisfsasdmngqtvnidaayvadalgevve
    nedlsrfil
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ofhG (G:)
    ttivsvrrngqvvvggdgqvslgntvmkgnarkvrrlyngkvlagfaggtadaftlfelf
    erklemhqghllksavelakdwrtdralrkleamlivadekesliitgigdvvqpeedqi
    laigsggnyalsaaralventelsaheivekslriagdicvftntnftieelpn
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ofhH (H:)
    ttivsvrrngqvvvggdgqvslgntvmkgnarkvrrlyngkvlagfaggtadaftlfelf
    erklemhqghllksavelakdwrtdralrkleamlivadekesliitgigdvvqpeedqi
    laigsggnyalsaaralventelsaheivekslriagdicvftntnftieelpn
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ofhI (I:)
    ttivsvrrngqvvvggdgqvslgntvmkgnarkvrrlyngkvlagfaggtadaftlfelf
    erklemhqghllksavelakdwrtdralrkleamlivadekesliitgigdvvqpeedqi
    laigsggnyalsaaralventelsaheivekslriagdicvftntnftieelpn
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ofhL (L:)
    ttivsvrrngqvvvggdgqvslgntvmkgnarkvrrlyngkvlagfaggtadaftlfelf
    erklemhqghllksavelakdwrtdralrkleamlivadekesliitgigdvvqpeedqi
    laigsggnyalsaaralventelsaheivekslriagdicvftntnftieelpn
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ofhM (M:)
    ttivsvrrngqvvvggdgqvslgntvmkgnarkvrrlyngkvlagfaggtadaftlfelf
    erklemhqghllksavelakdwrtdralrkleamlivadekesliitgigdvvqpeedqi
    laigsggnyalsaaralventelsaheivekslriagdicvftntnftieelpn
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ofhN (N:)
    ttivsvrrngqvvvggdgqvslgntvmkgnarkvrrlyngkvlagfaggtadaftlfelf
    erklemhqghllksavelakdwrtdralrkleamlivadekesliitgigdvvqpeedqi
    laigsggnyalsaaralventelsaheivekslriagdicvftntnftieelpn