PDB entry 1ofg

View 1ofg on RCSB PDB site
Description: glucose-fructose oxidoreductase
Class: oxidoreductase
Keywords: nadp binding, osmotic protection, oxidoreductase, periplasm
Deposited on 1996-10-17, released 1997-04-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.203
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glucose-fructose oxidoreductase
    Species: Zymomonas mobilis [TaxId:542]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ofga1, d1ofga2
  • Chain 'B':
    Compound: glucose-fructose oxidoreductase
    Species: Zymomonas mobilis [TaxId:542]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ofgb1, d1ofgb2
  • Chain 'C':
    Compound: glucose-fructose oxidoreductase
    Species: Zymomonas mobilis [TaxId:542]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ofgc1, d1ofgc2
  • Chain 'D':
    Compound: glucose-fructose oxidoreductase
    Species: Zymomonas mobilis [TaxId:542]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ofgd1, d1ofgd2
  • Chain 'E':
    Compound: glucose-fructose oxidoreductase
    Species: Zymomonas mobilis [TaxId:542]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ofge1, d1ofge2
  • Chain 'F':
    Compound: glucose-fructose oxidoreductase
    Species: Zymomonas mobilis [TaxId:542]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ofgf1, d1ofgf2
  • Heterogens: NDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ofgA (A:)
    atlpagasqvpttpagrpmpyairpmpedrrfgyaivglgkyalnqilpgfagcqhsrie
    alvsgnaekakivaaeygvdprkiydysnfdkiakdpkidavyiilpnslhaefairafk
    agkhvmcekpmatsvadcqrmidaakaankklmigyrchydpmnraavklirenqlgklg
    mvttdnsdvmdqndpaqqwrlrrelagggslmdigiyglngtryllgeepievraytysd
    pnderfvevedriiwqmrfrsgalshgassysttttsrfsvqgdkavllmdpatgyyqnl
    isvqtpghanqsmmpqfimpannqfsaqldhlaeavinnkpvrspgeegmqdvrliqaiy
    eaartgrpvntdwgyvrqggy
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ofgB (B:)
    atlpagasqvpttpagrpmpyairpmpedrrfgyaivglgkyalnqilpgfagcqhsrie
    alvsgnaekakivaaeygvdprkiydysnfdkiakdpkidavyiilpnslhaefairafk
    agkhvmcekpmatsvadcqrmidaakaankklmigyrchydpmnraavklirenqlgklg
    mvttdnsdvmdqndpaqqwrlrrelagggslmdigiyglngtryllgeepievraytysd
    pnderfvevedriiwqmrfrsgalshgassysttttsrfsvqgdkavllmdpatgyyqnl
    isvqtpghanqsmmpqfimpannqfsaqldhlaeavinnkpvrspgeegmqdvrliqaiy
    eaartgrpvntdwgyvrqggy
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ofgC (C:)
    atlpagasqvpttpagrpmpyairpmpedrrfgyaivglgkyalnqilpgfagcqhsrie
    alvsgnaekakivaaeygvdprkiydysnfdkiakdpkidavyiilpnslhaefairafk
    agkhvmcekpmatsvadcqrmidaakaankklmigyrchydpmnraavklirenqlgklg
    mvttdnsdvmdqndpaqqwrlrrelagggslmdigiyglngtryllgeepievraytysd
    pnderfvevedriiwqmrfrsgalshgassysttttsrfsvqgdkavllmdpatgyyqnl
    isvqtpghanqsmmpqfimpannqfsaqldhlaeavinnkpvrspgeegmqdvrliqaiy
    eaartgrpvntdwgyvrqggy
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ofgD (D:)
    atlpagasqvpttpagrpmpyairpmpedrrfgyaivglgkyalnqilpgfagcqhsrie
    alvsgnaekakivaaeygvdprkiydysnfdkiakdpkidavyiilpnslhaefairafk
    agkhvmcekpmatsvadcqrmidaakaankklmigyrchydpmnraavklirenqlgklg
    mvttdnsdvmdqndpaqqwrlrrelagggslmdigiyglngtryllgeepievraytysd
    pnderfvevedriiwqmrfrsgalshgassysttttsrfsvqgdkavllmdpatgyyqnl
    isvqtpghanqsmmpqfimpannqfsaqldhlaeavinnkpvrspgeegmqdvrliqaiy
    eaartgrpvntdwgyvrqggy
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ofgE (E:)
    atlpagasqvpttpagrpmpyairpmpedrrfgyaivglgkyalnqilpgfagcqhsrie
    alvsgnaekakivaaeygvdprkiydysnfdkiakdpkidavyiilpnslhaefairafk
    agkhvmcekpmatsvadcqrmidaakaankklmigyrchydpmnraavklirenqlgklg
    mvttdnsdvmdqndpaqqwrlrrelagggslmdigiyglngtryllgeepievraytysd
    pnderfvevedriiwqmrfrsgalshgassysttttsrfsvqgdkavllmdpatgyyqnl
    isvqtpghanqsmmpqfimpannqfsaqldhlaeavinnkpvrspgeegmqdvrliqaiy
    eaartgrpvntdwgyvrqggy
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ofgF (F:)
    atlpagasqvpttpagrpmpyairpmpedrrfgyaivglgkyalnqilpgfagcqhsrie
    alvsgnaekakivaaeygvdprkiydysnfdkiakdpkidavyiilpnslhaefairafk
    agkhvmcekpmatsvadcqrmidaakaankklmigyrchydpmnraavklirenqlgklg
    mvttdnsdvmdqndpaqqwrlrrelagggslmdigiyglngtryllgeepievraytysd
    pnderfvevedriiwqmrfrsgalshgassysttttsrfsvqgdkavllmdpatgyyqnl
    isvqtpghanqsmmpqfimpannqfsaqldhlaeavinnkpvrspgeegmqdvrliqaiy
    eaartgrpvntdwgyvrqggy