PDB entry 1ofd

View 1ofd on RCSB PDB site
Description: glutamate synthase from synechocystis sp in complex with 2-oxoglutarate at 2.0 angstrom resolution
Class: oxidoreductase
Keywords: oxidoreductase, complex enzyme, substrate channeling, amidotransferase, flavoprotein, iron-sulphur, fd-gogat
Deposited on 2003-04-14, released 2003-06-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.194
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferredoxin-dependent glutamate synthase 2
    Species: SYNECHOCYSTIS SP. [TaxId:1148]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P55038 (0-End)
      • conflict (577)
      • conflict (580)
      • conflict (1506)
    Domains in SCOPe 2.07: d1ofda1, d1ofda2, d1ofda3
  • Chain 'B':
    Compound: ferredoxin-dependent glutamate synthase 2
    Species: SYNECHOCYSTIS SP. [TaxId:1148]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P55038 (0-End)
      • conflict (577)
      • conflict (580)
      • conflict (1506)
    Domains in SCOPe 2.07: d1ofdb1, d1ofdb2, d1ofdb3
  • Heterogens: FMN, F3S, AKG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ofdA (A:)
    cgvgfianlrgkpdhtlveqalkalgcmehrggcsadndsgdgagvmtaiprellaqwfn
    trnlpmpdgdrlgvgmvflpqepsarevarayveevvrlekltvlgwrevpvnsdvlgiq
    aknnqphieqilvtcpegcagdeldrrlyiarsiigkklaedfyvcsfscrtivykgmvr
    siilgefyldlknpgytsnfavyhrrfstntmpkwplaqpmrllghngeintllgninwm
    aarekelevsgwtkaelealtpivnqansdsynldsalellvrtgrspleaamilvpeay
    knqpalkdypeisdfhdyysglqepwdgpallvfsdgkivgagldrnglrparycitkdd
    yivlgseagvvdlpevdivekgrlapgqmiavdlaeqkilknyqikqqaaqkypygewik
    iqrqtvasdsfaektlfndaqtvlqqqaafgytaedvemvvvpmasqgkeptfcmgddtp
    lavlshkprllydyfkqrfaqvtnppidplrenlvmslamflgkrgnllepkaesartik
    lrsplvnevelqaiktgqlqvaevstlydldgvnsledaltnlvktaiatvqagaeilvl
    tdrpngailtenqsfippllavgavhhhliraglrlkaslivdtaqcwsthhfaclvgyg
    asaicpylalesvrqwwldektqklmengrldridlptalknyrqsveaglfkilskmgi
    sllasyhgaqifeaiglgaelveyafagttsrvggltiadvagevmvfhgmafpemakkl
    enfgfvnyrpggeyhmnspemskslhkavaaykvggngnngeaydhyelyrqylkdrpvt
    alrdlldfnadqpaisleevesvesivkrfctggmslgalsreahetlaiamnrlgaksn
    sgeggedvvryltlddvdsegnsptlphlhglqngdtansaikqiasgrfgvtpeylmsg
    kqleikmaqgakpgeggqlpgkkvseyiamlrrskpgvtlisppphhdiysiedlaqliy
    dlhqinpeaqvsvklvaeigigtiaagvakanadiiqisghdggtgasplssikhagspw
    elgvtevhrvlmenqlrdrvllradgglktgwdvvmaalmgaeeygfgsiamiaegcima
    rvchtnncpvgvatqqerlrqrfkgvpgqvvnffyfiaeevrsllahlgyrslddiigrt
    dllkvrsdvqlsktqnltldcllnlpdtkqnrqwlnhepvhsngpvldddiladpdiqea
    inhqttatktyrlvntdrtvgtrlsgaiakkygnngfegnitlnfqgaagqsfgafnldg
    mtlhlqgeandyvgkgmnggeivivphpqasfapednviigntclygatggnlyangrag
    erfavrnsvgkaviegagdhcceymtggvivvlgpvgrnvgagmtgglayfldevgdlpe
    kinpeiitlqritaskgeeqlkslitahvehtgspkgkailanwsdylgkfwqavppsek
    dspeanndvsltgektltsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ofdA (A:)
    cgvgfianlrgkpdhtlveqalkalgcmehrggcsadndsgdgagvmtaiprellaqwfn
    trnlpmpdgdrlgvgmvflpqepsarevarayveevvrlekltvlgwrevpvnsdvlgiq
    aknnqphieqilvtcpegcagdeldrrlyiarsiigkklaedfyvcsfscrtivykgmvr
    siilgefyldlknpgytsnfavyhrrfstntmpkwplaqpmrllghngeintllgninwm
    aarekelevsgwtkaelealtpivnqansdsynldsalellvrtgrspleaamilvpeay
    knqpalkdypeisdfhdyysglqepwdgpallvfsdgkivgagldrnglrparycitkdd
    yivlgseagvvdlpevdivekgrlapgqmiavdlaeqkilknyqikqqaaqkypygewik
    iqrqtvasdsfaektlfndaqtvlqqqaafgytaedvemvvvpmasqgkeptfcmgddtp
    lavlshkprllydyfkqrfaqvtnppidplrenlvmslamflgkrgnllepkaesartik
    lrsplvnevelqaiktgqlqvaevstlydldgvnsledaltnlvktaiatvqagaeilvl
    tdrpngailtenqsfippllavgavhhhliraglrlkaslivdtaqcwsthhfaclvgyg
    asaicpylalesvrqwwldektqklmengrldridlptalknyrqsveaglfkilskmgi
    sllasyhgaqifeaiglgaelveyafagttsrvggltiadvagevmvfhgmafkklenfg
    fvnyrpggeyhmnspemskslhkavaaydhyelyrqylkdrpvtalrdlldfnadqpais
    leevesvesivkrfctggmslgalsreahetlaiamnrlgaksnsgeggedvvryltldd
    vdsegnsptlphlhglqngdtansaikqiasgrfgvtpeylmsgkqleikmaqgakpgeg
    gqlpgkkvseyiamlrrskpgvtlisppphhdiysiedlaqliydlhqinpeaqvsvklv
    aeigigtiaagvakanadiiqisghdggtgasplssikhagspwelgvtevhrvlmenql
    rdrvllradgglktgwdvvmaalmgaeeygfgsiamiaegcimarvchtnncpvgvatqq
    erlrqrfkgvpgqvvnffyfiaeevrsllahlgyrslddiigrtdllkvrsdvqlsktqn
    ltldcllnlpdtkqnrqwlnhepvhsngpvldddiladpdiqeainhqttatktyrlvnt
    drtvgtrlsgaiakkygnngfegnitlnfqgaagqsfgafnldgmtlhlqgeandyvgkg
    mnggeivivphpqasfapednviigntclygatggnlyangragerfavrnsvgkavieg
    agdhcceymtggvivvlgpvgrnvgagmtgglayfldevgdlpekinpeiitlqritask
    geeqlkslitahvehtgspkgkailanwsdylgkfwqavppsekdspeann
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ofdB (B:)
    cgvgfianlrgkpdhtlveqalkalgcmehrggcsadndsgdgagvmtaiprellaqwfn
    trnlpmpdgdrlgvgmvflpqepsarevarayveevvrlekltvlgwrevpvnsdvlgiq
    aknnqphieqilvtcpegcagdeldrrlyiarsiigkklaedfyvcsfscrtivykgmvr
    siilgefyldlknpgytsnfavyhrrfstntmpkwplaqpmrllghngeintllgninwm
    aarekelevsgwtkaelealtpivnqansdsynldsalellvrtgrspleaamilvpeay
    knqpalkdypeisdfhdyysglqepwdgpallvfsdgkivgagldrnglrparycitkdd
    yivlgseagvvdlpevdivekgrlapgqmiavdlaeqkilknyqikqqaaqkypygewik
    iqrqtvasdsfaektlfndaqtvlqqqaafgytaedvemvvvpmasqgkeptfcmgddtp
    lavlshkprllydyfkqrfaqvtnppidplrenlvmslamflgkrgnllepkaesartik
    lrsplvnevelqaiktgqlqvaevstlydldgvnsledaltnlvktaiatvqagaeilvl
    tdrpngailtenqsfippllavgavhhhliraglrlkaslivdtaqcwsthhfaclvgyg
    asaicpylalesvrqwwldektqklmengrldridlptalknyrqsveaglfkilskmgi
    sllasyhgaqifeaiglgaelveyafagttsrvggltiadvagevmvfhgmafpemakkl
    enfgfvnyrpggeyhmnspemskslhkavaaykvggngnngeaydhyelyrqylkdrpvt
    alrdlldfnadqpaisleevesvesivkrfctggmslgalsreahetlaiamnrlgaksn
    sgeggedvvryltlddvdsegnsptlphlhglqngdtansaikqiasgrfgvtpeylmsg
    kqleikmaqgakpgeggqlpgkkvseyiamlrrskpgvtlisppphhdiysiedlaqliy
    dlhqinpeaqvsvklvaeigigtiaagvakanadiiqisghdggtgasplssikhagspw
    elgvtevhrvlmenqlrdrvllradgglktgwdvvmaalmgaeeygfgsiamiaegcima
    rvchtnncpvgvatqqerlrqrfkgvpgqvvnffyfiaeevrsllahlgyrslddiigrt
    dllkvrsdvqlsktqnltldcllnlpdtkqnrqwlnhepvhsngpvldddiladpdiqea
    inhqttatktyrlvntdrtvgtrlsgaiakkygnngfegnitlnfqgaagqsfgafnldg
    mtlhlqgeandyvgkgmnggeivivphpqasfapednviigntclygatggnlyangrag
    erfavrnsvgkaviegagdhcceymtggvivvlgpvgrnvgagmtgglayfldevgdlpe
    kinpeiitlqritaskgeeqlkslitahvehtgspkgkailanwsdylgkfwqavppsek
    dspeanndvsltgektltsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ofdB (B:)
    cgvgfianlrgkpdhtlveqalkalgcmehrggcsadndsgdgagvmtaiprellaqwfn
    trnlpmpdgdrlgvgmvflpqepsarevarayveevvrlekltvlgwrevpvnsdvlgiq
    aknnqphieqilvtcpegcagdeldrrlyiarsiigkklaedfyvcsfscrtivykgmvr
    siilgefyldlknpgytsnfavyhrrfstntmpkwplaqpmrllghngeintllgninwm
    aarekelevsgwtkaelealtpivnqansdsynldsalellvrtgrspleaamilvpeay
    knqpalkdypeisdfhdyysglqepwdgpallvfsdgkivgagldrnglrparycitkdd
    yivlgseagvvdlpevdivekgrlapgqmiavdlaeqkilknyqikqqaaqkypygewik
    iqrqtvasdsfaektlfndaqtvlqqqaafgytaedvemvvvpmasqgkeptfcmgddtp
    lavlshkprllydyfkqrfaqvtnppidplrenlvmslamflgkrgnllepkaesartik
    lrsplvnevelqaiktgqlqvaevstlydldgvnsledaltnlvktaiatvqagaeilvl
    tdrpngailtenqsfippllavgavhhhliraglrlkaslivdtaqcwsthhfaclvgyg
    asaicpylalesvrqwwldektqklmengrldridlptalknyrqsveaglfkilskmgi
    sllasyhgaqifeaiglgaelveyafagttsrvggltiadvagevmvfhgmafkklenfg
    fvnyrpggeyhmnspemskslhkavaaydhyelyrqylkdrpvtalrdlldfnadqpais
    leevesvesivkrfctggmslgalsreahetlaiamnrlgaksnsgeggedvvryltldd
    vdsegnsptlphlhglqngdtansaikqiasgrfgvtpeylmsgkqleikmaqgakpgeg
    gqlpgkkvseyiamlrrskpgvtlisppphhdiysiedlaqliydlhqinpeaqvsvklv
    aeigigtiaagvakanadiiqisghdggtgasplssikhagspwelgvtevhrvlmenql
    rdrvllradgglktgwdvvmaalmgaeeygfgsiamiaegcimarvchtnncpvgvatqq
    erlrqrfkgvpgqvvnffyfiaeevrsllahlgyrslddiigrtdllkvrsdvqlsktqn
    ltldcllnlpdtkqnrqwlnhepvhsngpvldddiladpdiqeainhqttatktyrlvnt
    drtvgtrlsgaiakkygnngfegnitlnfqgaagqsfgafnldgmtlhlqgeandyvgkg
    mnggeivivphpqasfapednviigntclygatggnlyangragerfavrnsvgkavieg
    agdhcceymtggvivvlgpvgrnvgagmtgglayfldevgdlpekinpeiitlqritask
    geeqlkslitahvehtgspkgkailanwsdylgkfwqavppsekdspeann