PDB entry 1of9

View 1of9 on RCSB PDB site
Description: solution structure of the pore forming toxin of entamoeba histolytica (amoebapore a)
Class: toxin
Keywords: pore forming, toxin, saplip, amoebapore a
Deposited on 2003-04-09, released 2004-02-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pore-forming peptide ameobapore a
    Species: Entamoeba histolytica [TaxId:5759]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1of9a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1of9A (A:)
    geilcnlctglintlenllttkgadkvkdyisslcnkasgfiatlctkvldfgidkliql
    iedkvdanaicakihac