PDB entry 1of7

View 1of7 on RCSB PDB site
Description: the structure of human mitochondrial aldehyde dehydrogenase in complex with the antidipsotropic inhibitor daidzin
Class: oxidoreductase
Keywords: aldehyde dehydrogenase, alcohol abuse, oxidoreductase, daidzin, mitochondrion
Deposited on 2003-04-08, released 2004-05-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2008-08-19, with a file datestamp of 2008-08-15.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.192
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aldehyde dehydrogenase, mitochondrial
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1of7a_
  • Chain 'B':
    Compound: aldehyde dehydrogenase, mitochondrial
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1of7b_
  • Chain 'C':
    Compound: aldehyde dehydrogenase, mitochondrial
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: aldehyde dehydrogenase, mitochondrial
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: aldehyde dehydrogenase, mitochondrial
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: aldehyde dehydrogenase, mitochondrial
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: aldehyde dehydrogenase, mitochondrial
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1of7g_
  • Chain 'H':
    Compound: aldehyde dehydrogenase, mitochondrial
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
  • Heterogens: DZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1of7A (A:)
    saaatqavpapnqqpevfcnqifinnewhdavsrktfptvnpstgevicqvaegdkedvd
    kavkaaraafqlgspwrrmdashrgrllnrladlierdrtylaaletldngkpyvisylv
    dldmvlkclryyagwadkyhgktipidgdffsytrhepvgvcgqiipwnfpllmqawklg
    palatgnvvvmkvaeqtpltalyvanlikeagfppgvvnivpgfgptagaaiashedvdk
    vaftgsteigrviqvaagssnlkrvtlelggkspniimsdadmdwaveqahfalffnqgq
    cccagsrtfvqediydefversvaraksrvvgnpfdskteqgpqvdetqfkkilgyintg
    kqegakllcgggiaadrgyfiqptvfgdvqdgmtiakeeifgpvmqilkfktieevvgra
    nnstyglaaavftkdldkanylsqalqagtvwvncydvfgaqspfggykmsgsgrelgey
    glqaytevktvtvkvpqkns
    

    Sequence, based on observed residues (ATOM records): (download)
    >1of7A (A:)
    avpapnqqpevfcnqifinnewhdavsrktfptvnpstgevicqvaegdkedvdkavkaa
    raafqlgspwrrmdashrgrllnrladlierdrtylaaletldngkpyvisylvdldmvl
    kclryyagwadkyhgktipidgdffsytrhepvgvcgqiipwnfpllmqawklgpalatg
    nvvvmkvaeqtpltalyvanlikeagfppgvvnivpgfgptagaaiashedvdkvaftgs
    teigrviqvaagssnlkrvtlelggkspniimsdadmdwaveqahfalffnqgqcccags
    rtfvqediydefversvaraksrvvgnpfdskteqgpqvdetqfkkilgyintgkqegak
    llcgggiaadrgyfiqptvfgdvqdgmtiakeeifgpvmqilkfktieevvgrannstyg
    laaavftkdldkanylsqalqagtvwvncydvfgaqspfggykmsgsgrelgeyglqayt
    evktvtvkvpqkns
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1of7B (B:)
    saaatqavpapnqqpevfcnqifinnewhdavsrktfptvnpstgevicqvaegdkedvd
    kavkaaraafqlgspwrrmdashrgrllnrladlierdrtylaaletldngkpyvisylv
    dldmvlkclryyagwadkyhgktipidgdffsytrhepvgvcgqiipwnfpllmqawklg
    palatgnvvvmkvaeqtpltalyvanlikeagfppgvvnivpgfgptagaaiashedvdk
    vaftgsteigrviqvaagssnlkrvtlelggkspniimsdadmdwaveqahfalffnqgq
    cccagsrtfvqediydefversvaraksrvvgnpfdskteqgpqvdetqfkkilgyintg
    kqegakllcgggiaadrgyfiqptvfgdvqdgmtiakeeifgpvmqilkfktieevvgra
    nnstyglaaavftkdldkanylsqalqagtvwvncydvfgaqspfggykmsgsgrelgey
    glqaytevktvtvkvpqkns
    

    Sequence, based on observed residues (ATOM records): (download)
    >1of7B (B:)
    avpapnqqpevfcnqifinnewhdavsrktfptvnpstgevicqvaegdkedvdkavkaa
    raafqlgspwrrmdashrgrllnrladlierdrtylaaletldngkpyvisylvdldmvl
    kclryyagwadkyhgktipidgdffsytrhepvgvcgqiipwnfpllmqawklgpalatg
    nvvvmkvaeqtpltalyvanlikeagfppgvvnivpgfgptagaaiashedvdkvaftgs
    teigrviqvaagssnlkrvtlelggkspniimsdadmdwaveqahfalffnqgqcccags
    rtfvqediydefversvaraksrvvgnpfdskteqgpqvdetqfkkilgyintgkqegak
    llcgggiaadrgyfiqptvfgdvqdgmtiakeeifgpvmqilkfktieevvgrannstyg
    laaavftkdldkanylsqalqagtvwvncydvfgaqspfggykmsgsgrelgeyglqayt
    evktvtvkvpqkns
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1of7G (G:)
    saaatqavpapnqqpevfcnqifinnewhdavsrktfptvnpstgevicqvaegdkedvd
    kavkaaraafqlgspwrrmdashrgrllnrladlierdrtylaaletldngkpyvisylv
    dldmvlkclryyagwadkyhgktipidgdffsytrhepvgvcgqiipwnfpllmqawklg
    palatgnvvvmkvaeqtpltalyvanlikeagfppgvvnivpgfgptagaaiashedvdk
    vaftgsteigrviqvaagssnlkrvtlelggkspniimsdadmdwaveqahfalffnqgq
    cccagsrtfvqediydefversvaraksrvvgnpfdskteqgpqvdetqfkkilgyintg
    kqegakllcgggiaadrgyfiqptvfgdvqdgmtiakeeifgpvmqilkfktieevvgra
    nnstyglaaavftkdldkanylsqalqagtvwvncydvfgaqspfggykmsgsgrelgey
    glqaytevktvtvkvpqkns
    

    Sequence, based on observed residues (ATOM records): (download)
    >1of7G (G:)
    avpapnqqpevfcnqifinnewhdavsrktfptvnpstgevicqvaegdkedvdkavkaa
    raafqlgspwrrmdashrgrllnrladlierdrtylaaletldngkpyvisylvdldmvl
    kclryyagwadkyhgktipidgdffsytrhepvgvcgqiipwnfpllmqawklgpalatg
    nvvvmkvaeqtpltalyvanlikeagfppgvvnivpgfgptagaaiashedvdkvaftgs
    teigrviqvaagssnlkrvtlelggkspniimsdadmdwaveqahfalffnqgqcccags
    rtfvqediydefversvaraksrvvgnpfdskteqgpqvdetqfkkilgyintgkqegak
    llcgggiaadrgyfiqptvfgdvqdgmtiakeeifgpvmqilkfktieevvgrannstyg
    laaavftkdldkanylsqalqagtvwvncydvfgaqspfggykmsgsgrelgeyglqayt
    evktvtvkvpqkns
    

  • Chain 'H':
    No sequence available.