PDB entry 1of6

View 1of6 on RCSB PDB site
Description: crystal structure of the tyrosine-regulated 3-deoxy-d-arabino-heptulosonate-7-phosphate synthase from saccharomyces cerevisiae complexed with tyrosine and manganese
Class: lyase
Keywords: beta-alpha-barrel, lyase, synthase, aldolase, synthetase
Deposited on 2003-04-08, released 2004-05-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-02-05, with a file datestamp of 2014-01-31.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.195
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospho-2-dehydro-3-deoxyheptonate aldolase, tyrosine-inhibited
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1of6a_
  • Chain 'B':
    Compound: phospho-2-dehydro-3-deoxyheptonate aldolase, tyrosine-inhibited
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1of6b_
  • Chain 'C':
    Compound: phospho-2-dehydro-3-deoxyheptonate aldolase, tyrosine-inhibited
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1of6c_
  • Chain 'D':
    Compound: phospho-2-dehydro-3-deoxyheptonate aldolase, tyrosine-inhibited
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1of6d_
  • Chain 'E':
    Compound: phospho-2-dehydro-3-deoxyheptonate aldolase, tyrosine-inhibited
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1of6e_
  • Chain 'F':
    Compound: phospho-2-dehydro-3-deoxyheptonate aldolase, tyrosine-inhibited
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1of6f_
  • Chain 'G':
    Compound: phospho-2-dehydro-3-deoxyheptonate aldolase, tyrosine-inhibited
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1of6g_
  • Chain 'H':
    Compound: phospho-2-dehydro-3-deoxyheptonate aldolase, tyrosine-inhibited
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1of6h_
  • Heterogens: MN, DTY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1of6A (A:)
    msespmfaangmpkvnqgaeedvrilgydplaspallqvqipatptsletakrgrreaid
    iitgkddrvlvivgpcsihdleaaqeyalrlkklsdelkgdlsiimraylekprttvgwk
    glindpdvnntfninkglqsarqlfvnltniglpigsemldtispqyladlvsfgaigar
    ttesqlhrelasglsfpvgfkngtdgtlnvavdacqaaahshhfmgvtkhgvaaitttkg
    nehcfvilrggkkgtnydaksvaeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvc
    eqiangenaitgvmiesninegnqgipaegkaglkygvsitdacigwettedvlrklaaa
    vrqrrevnkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1of6A (A:)
    gaeedvrilgydplaspallqvqipatptsletakrgrreaidiitgkddrvlvivgpcs
    ihdleaaqeyalrlkklsdelkgdlsiimraylekprtvgwkglindpdvnntfninkgl
    qsarqlfvnltniglpigsemldtispqyladlvsfgaigarttesqlhrelasglsfpv
    gfkngtdgtlnvavdacqaaahshhfmgvtkhgvaaitttkgnehcfvilrggkkgtnyd
    aksvaeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvceqiangenaitgvmiesn
    inegnqgipaegkaglkygvsitdacigwettedvlrklaaavrqrrevn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1of6B (B:)
    msespmfaangmpkvnqgaeedvrilgydplaspallqvqipatptsletakrgrreaid
    iitgkddrvlvivgpcsihdleaaqeyalrlkklsdelkgdlsiimraylekprttvgwk
    glindpdvnntfninkglqsarqlfvnltniglpigsemldtispqyladlvsfgaigar
    ttesqlhrelasglsfpvgfkngtdgtlnvavdacqaaahshhfmgvtkhgvaaitttkg
    nehcfvilrggkkgtnydaksvaeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvc
    eqiangenaitgvmiesninegnqgipaegkaglkygvsitdacigwettedvlrklaaa
    vrqrrevnkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1of6B (B:)
    aeedvrilgydplaspallqvqipatptsletakrgrreaidiitgkddrvlvivgpcsi
    hdleaaqeyalrlkklsdelkgdlsiimraylekprvgwkglindpdvnntfninkglqs
    arqlfvnltniglpigsemldtispqyladlvsfgaigarttesqlhrelasglsfpvgf
    kngtdgtlnvavdacqaaahshhfmgvtkhgvaaitttkgnehcfvilrggkgtnydaks
    vaeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvceqiangenaitgvmiesnine
    gnqgipaegkalkygvsitdacigwettedvlrklaaavrqrrevn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1of6C (C:)
    msespmfaangmpkvnqgaeedvrilgydplaspallqvqipatptsletakrgrreaid
    iitgkddrvlvivgpcsihdleaaqeyalrlkklsdelkgdlsiimraylekprttvgwk
    glindpdvnntfninkglqsarqlfvnltniglpigsemldtispqyladlvsfgaigar
    ttesqlhrelasglsfpvgfkngtdgtlnvavdacqaaahshhfmgvtkhgvaaitttkg
    nehcfvilrggkkgtnydaksvaeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvc
    eqiangenaitgvmiesninegnqgipaegkaglkygvsitdacigwettedvlrklaaa
    vrqrrevnkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1of6C (C:)
    gaeedvrilgydplaspallqvqipatptsletakrgrreaidiitgkddrvlvivgpcs
    ihdleaaqeyalrlkklsdelkgdlsiimraylekprvgwkglindpdvnntfninkglq
    sarqlfvnltniglpigsemldtispqyladlvsfgaigarttesqlhrelasglsfpvg
    fkngtdgtlnvavdacqaaahshhfmgvtkhgvaaitttkgnehcfvilrggkkgtnyda
    ksvaeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvceqiangenaitgvmiesni
    negnqgipaegkaglkygvsitdacigwettedvlrklaaavrqrrevnk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1of6D (D:)
    msespmfaangmpkvnqgaeedvrilgydplaspallqvqipatptsletakrgrreaid
    iitgkddrvlvivgpcsihdleaaqeyalrlkklsdelkgdlsiimraylekprttvgwk
    glindpdvnntfninkglqsarqlfvnltniglpigsemldtispqyladlvsfgaigar
    ttesqlhrelasglsfpvgfkngtdgtlnvavdacqaaahshhfmgvtkhgvaaitttkg
    nehcfvilrggkkgtnydaksvaeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvc
    eqiangenaitgvmiesninegnqgipaegkaglkygvsitdacigwettedvlrklaaa
    vrqrrevnkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1of6D (D:)
    gaeedvrilgydplaspallqvqipatptsletakrgrreaidiitgkddrvlvivgpcs
    ihdleaaqeyalrlkklsdelkgdlsiimraylekprvgwkglindpdvnntfninkglq
    sarqlfvnltniglpigsemldtispqyladlvsfgaigarttesqlhrelasglsfpvg
    fkngtdgtlnvavdacqaaahshhfmgvtkhgvaaitttkgnehcfvilrggkkgtnyda
    ksvaeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvceqiangenaitgvmiesni
    negnqgipaegkaglkygvsitdacigwettedvlrklaaavrqrrevn
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1of6E (E:)
    msespmfaangmpkvnqgaeedvrilgydplaspallqvqipatptsletakrgrreaid
    iitgkddrvlvivgpcsihdleaaqeyalrlkklsdelkgdlsiimraylekprttvgwk
    glindpdvnntfninkglqsarqlfvnltniglpigsemldtispqyladlvsfgaigar
    ttesqlhrelasglsfpvgfkngtdgtlnvavdacqaaahshhfmgvtkhgvaaitttkg
    nehcfvilrggkkgtnydaksvaeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvc
    eqiangenaitgvmiesninegnqgipaegkaglkygvsitdacigwettedvlrklaaa
    vrqrrevnkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1of6E (E:)
    gaeedvrilgydplaspallqvqipatptsletakrgrreaidiitgkddrvlvivgpcs
    ihdleaaqeyalrlkklsdelkgdlsiimraylekpwkglindpdvnntfninkglqsar
    qlfvnltniglpigsemldtispqyladlvsfgaigarttesqlhrelasglsfpvgfkn
    gtdgtlnvavdacqaaahshhfmgvtkhgvaaitttkgnehcfvilrggkkgtnydaksv
    aeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvceqiangenaitgvmiesnineg
    nqgipkygvsitdacigwettedvlrklaaavrqrrevn
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1of6F (F:)
    msespmfaangmpkvnqgaeedvrilgydplaspallqvqipatptsletakrgrreaid
    iitgkddrvlvivgpcsihdleaaqeyalrlkklsdelkgdlsiimraylekprttvgwk
    glindpdvnntfninkglqsarqlfvnltniglpigsemldtispqyladlvsfgaigar
    ttesqlhrelasglsfpvgfkngtdgtlnvavdacqaaahshhfmgvtkhgvaaitttkg
    nehcfvilrggkkgtnydaksvaeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvc
    eqiangenaitgvmiesninegnqgipaegkaglkygvsitdacigwettedvlrklaaa
    vrqrrevnkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1of6F (F:)
    gaeedvrilgydplaspallqvqipatptsletakrgrreaidiitgkddrvlvivgpcs
    ihdleaaqeyalrlkklsdelkgdlsiimraylekprvgwkglindpdvnntfninkglq
    sarqlfvnltniglpigsemldtispqyladlvsfgaigarttesqlhrelasglsfpvg
    fkngtdgtlnvavdacqaaahshhfmgvtkhgvaaitttkgnehcfvilrggkkgtnyda
    ksvaeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvceqiangenaitgvmiesni
    negnqgipgkaglkygvsitdacigwettedvlrklaaavrqrrevn
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1of6G (G:)
    msespmfaangmpkvnqgaeedvrilgydplaspallqvqipatptsletakrgrreaid
    iitgkddrvlvivgpcsihdleaaqeyalrlkklsdelkgdlsiimraylekprttvgwk
    glindpdvnntfninkglqsarqlfvnltniglpigsemldtispqyladlvsfgaigar
    ttesqlhrelasglsfpvgfkngtdgtlnvavdacqaaahshhfmgvtkhgvaaitttkg
    nehcfvilrggkkgtnydaksvaeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvc
    eqiangenaitgvmiesninegnqgipaegkaglkygvsitdacigwettedvlrklaaa
    vrqrrevnkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1of6G (G:)
    aeedvrilgydplaspallqvqipatptsletakrgrreaidiitgkddrvlvivgpcsi
    hdleaaqeyalrlkklsdelkgdlsiimraylekpgwkglindpdvnntfninkglqsar
    qlfvnltniglpigsemldtispqyladlvsfgaigarttesqlhrelasglsfpvgfkn
    gtdgtlnvavdacqaaahshhfmgvtkhgvaaitttkgnehcfvilrggkkgtnydaksv
    aeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvceqiangenaitgvmiesnineg
    nqipaeaglkygvsitdacigwettedvlrklaaavrqrrev
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1of6H (H:)
    msespmfaangmpkvnqgaeedvrilgydplaspallqvqipatptsletakrgrreaid
    iitgkddrvlvivgpcsihdleaaqeyalrlkklsdelkgdlsiimraylekprttvgwk
    glindpdvnntfninkglqsarqlfvnltniglpigsemldtispqyladlvsfgaigar
    ttesqlhrelasglsfpvgfkngtdgtlnvavdacqaaahshhfmgvtkhgvaaitttkg
    nehcfvilrggkkgtnydaksvaeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvc
    eqiangenaitgvmiesninegnqgipaegkaglkygvsitdacigwettedvlrklaaa
    vrqrrevnkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1of6H (H:)
    gaeedvrilgydplaspallqvqipatptsletakrgrreaidiitgkddrvlvivgpcs
    ihdleaaqeyalrlkklsdelkgdlsiimraylekprttvgwkglindpdvnntfninkg
    lqsarqlfvnltniglpigsemldtispqyladlvsfgaigarttesqlhrelasglsfp
    vgfkngtdgtlnvavdacqaaahshhfmgvtkhgvaaitttkgnehcfvilrggkkgtny
    daksvaeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvceqiangenaitgvmies
    ninegnqgipaaglkygvsitdacigwettedvlrklaaavrqrrev