PDB entry 1of1

View 1of1 on RCSB PDB site
Description: kinetics and crystal structure of the herpes simplex virus type 1 thymidine kinase interacting with (south)-methanocarba-thymidine
Class: transferase
Keywords: transferase, thymidine kinase, antiviral drug, enzyme-prodrug gene, kinase, DNA synthesis, ATP-binding
Deposited on 2003-04-03, released 2004-06-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.184
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thymidine kinase
    Species: HERPES SIMPLEX VIRUS (TYPE 1 / STRAIN 17) [TaxId:10299]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1of1a_
  • Chain 'B':
    Compound: Thymidine kinase
    Species: HERPES SIMPLEX VIRUS (TYPE 1 / STRAIN 17) [TaxId:10299]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1of1b_
  • Heterogens: SCT, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1of1A (A:)
    masypchqhasafdqaarsrghnnrrtalrprrqqeatevrpeqkmptllrvyidgphgm
    gkttttqllvalgsrddivyvpepmtywrvlgasetianiyttqhrldqgeisagdaavv
    mtsaqitmgmpyavtdavlaphiggeagsshapppaltlifdrhpiaallcypaarylmg
    smtpqavlafvalipptlpgtnivlgalpedrhidrlakrqrpgerldlamlaairrvyg
    llantvrylqcggswredwgqlsgtavppqgaepqsnagprphigdtlftlfrapellap
    ngdlynvfawaldvlakrlrsmhvfildydqspagcrdallqltsgmvqthvttpgsipt
    icdlartfaremgean
    

    Sequence, based on observed residues (ATOM records): (download)
    >1of1A (A:)
    mptllrvyidgphgmgkttttqllvaddivyvpepmtywrvlgasetianiyttqhrldq
    geisagdaavvmtsaqitmgmpyavtdavlaphiggeapppaltlifdrhpiaallcypa
    arylmgsmtpqavlafvalipptlpgtnivlgalpedrhidrlakrqrpgerldlamlaa
    irrvygllantvrylqcggswredwgqlsgtgprphigdtlftlfrapellapngdlynv
    fawaldvlakrlrsmhvfildydqspagcrdallqltsgmvqthvttpgsipticdlart
    faremgea
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1of1B (B:)
    masypchqhasafdqaarsrghnnrrtalrprrqqeatevrpeqkmptllrvyidgphgm
    gkttttqllvalgsrddivyvpepmtywrvlgasetianiyttqhrldqgeisagdaavv
    mtsaqitmgmpyavtdavlaphiggeagsshapppaltlifdrhpiaallcypaarylmg
    smtpqavlafvalipptlpgtnivlgalpedrhidrlakrqrpgerldlamlaairrvyg
    llantvrylqcggswredwgqlsgtavppqgaepqsnagprphigdtlftlfrapellap
    ngdlynvfawaldvlakrlrsmhvfildydqspagcrdallqltsgmvqthvttpgsipt
    icdlartfaremgean
    

    Sequence, based on observed residues (ATOM records): (download)
    >1of1B (B:)
    mptllrvyidgphgmgkttttqllvalgsrddivyvpepmtywrvlgasetianiyttqh
    rldqgeisagdaavvmtsaqitmgmpyavtdavlaphiggeapppaltlifdrhpiaall
    cypaarylmgsmtpqavlafvalipptlpgtnivlgalpedrhidrlakrgerldlamla
    airrvygllantvrylqcggswredwgqlsgtpqsnagprphigdtlftlfrapellapn
    gdlynvfawaldvlakrlrsmhvfildydqspagcrdallqltsgmvqthvttpgsipti
    cdlartfaremgea