PDB entry 1oey

View 1oey on RCSB PDB site
Description: heterodimer of p40phox and p67phox pb1 domains from human nadph oxidase
Deposited on 2003-04-02, released 2003-07-29
The last revision prior to the SCOP 1.67 freeze date was dated 2003-07-29, with a file datestamp of 2003-07-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.21206
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1oeya_
  • Chain 'B':
    Domains in SCOP 1.67: d1oeyb_
  • Chain 'C':
    Domains in SCOP 1.67: d1oeyc_
  • Chain 'D':
    Domains in SCOP 1.67: d1oeyd_
  • Chain 'J':
    Domains in SCOP 1.67: d1oeyj_
  • Chain 'K':
    Domains in SCOP 1.67: d1oeyk_
  • Chain 'L':
    Domains in SCOP 1.67: d1oeyl_
  • Chain 'M':
    Domains in SCOP 1.67: d1oeym_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oeyA (A:)
    gshmaytlkvhykytvvmktqpglpysqvrdmvskklelrlehtklsyrprdsnelvpls
    edsmkdawgqvknycltlwcent
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oeyA (A:)
    gshmaytlkvhykytvvmktqpglpysqvrdmvskklelrlehtklsyrprdsnelvpls
    edsmkdawgqvknycltlwcen
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1oeyB (B:)
    gshmaytlkvhykytvvmktqpglpysqvrdmvskklelrlehtklsyrprdsnelvpls
    edsmkdawgqvknycltlwcent
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oeyB (B:)
    aytlkvhykytvvmktqpglpysqvrdmvskklelrlehtklsyrprdsnelvplsedsm
    kdawgqvknycltlwce
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1oeyC (C:)
    gshmaytlkvhykytvvmktqpglpysqvrdmvskklelrlehtklsyrprdsnelvpls
    edsmkdawgqvknycltlwcent
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oeyC (C:)
    ytlkvhykytvvmktqpglpysqvrdmvskklelrlehtklsyrprdsnelvplsedsmk
    dawgqvknycltlwcen
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1oeyD (D:)
    gshmaytlkvhykytvvmktqpglpysqvrdmvskklelrlehtklsyrprdsnelvpls
    edsmkdawgqvknycltlwcent
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oeyD (D:)
    maytlkvhykytvvmktqpglpysqvrdmvskklelrlehtklsyrprdsnelvplseds
    mkdawgqvknycltlwcen
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1oeyJ (J:)
    gshmtnwlrvyyyedtistikdiaveedlsstpllkdlleltrrefqredialnyrdaeg
    dlvrllsdedvalmvrqarglpsqkrlfpwklhitqkdnyrvyntmp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oeyJ (J:)
    hmtnwlrvyyyedtistikdiaveedlsstpllkdlleltrrefqredialnyrdaegdl
    vrllsdedvalmvrqarglpsqkrlfpwklhitqkdnyrvyntmp
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1oeyK (K:)
    gshmtnwlrvyyyedtistikdiaveedlsstpllkdlleltrrefqredialnyrdaeg
    dlvrllsdedvalmvrqarglpsqkrlfpwklhitqkdnyrvyntmp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oeyK (K:)
    mtnwlrvyyyedtistikdiaveedlsstpllkdlleltrrefqredialnyrdaegdlv
    rllsdedvalmvrqarglpsqkrlfpwklhitqkdnyrvyntmp
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1oeyL (L:)
    gshmtnwlrvyyyedtistikdiaveedlsstpllkdlleltrrefqredialnyrdaeg
    dlvrllsdedvalmvrqarglpsqkrlfpwklhitqkdnyrvyntmp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oeyL (L:)
    mtnwlrvyyyedtistikdiaveedlsstpllkdlleltrrefqredialnyrdaegdlv
    rllsdedvalmvrqargrlfpwklhitqkdnyrvyntmp
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1oeyM (M:)
    gshmtnwlrvyyyedtistikdiaveedlsstpllkdlleltrrefqredialnyrdaeg
    dlvrllsdedvalmvrqarglpsqkrlfpwklhitqkdnyrvyntmp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oeyM (M:)
    tnwlrvyyyedtistikdiaveedlsstpllkdlleltrrefqredialnyrdaegdlvr
    llsdedvalmvrqarkrlfpwklhitqkdnyrvyntmp