PDB entry 1oer

View 1oer on RCSB PDB site
Description: kas I lys328ala mutant in complex with fatty acid
Class: transferase
Keywords: condensing enzyme, fatty acid biosynthesis, transferase
Deposited on 2003-03-31, released 2004-05-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2004-05-21, with a file datestamp of 2007-06-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.171
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-oxoacyl-[acyl-carrier-protein] synthase I
    Species: ESCHERICHIA COLI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A953
      • engineered mutation (15)
      • engineered mutation (339)
    • Uniprot P14926 (12-417)
    Domains in SCOPe 2.07: d1oera3, d1oera4
  • Chain 'B':
    Compound: 3-oxoacyl-[acyl-carrier-protein] synthase I
    Species: ESCHERICHIA COLI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A953
      • engineered mutation (15)
      • engineered mutation (339)
    • Uniprot P14926 (12-417)
    Domains in SCOPe 2.07: d1oerb3, d1oerb4
  • Chain 'C':
    Compound: 3-oxoacyl-[acyl-carrier-protein] synthase I
    Species: ESCHERICHIA COLI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A953
      • engineered mutation (15)
      • engineered mutation (339)
    • Uniprot P14926 (12-417)
    Domains in SCOPe 2.07: d1oerc3, d1oerc4
  • Chain 'D':
    Compound: 3-oxoacyl-[acyl-carrier-protein] synthase I
    Species: ESCHERICHIA COLI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A953
      • engineered mutation (15)
      • engineered mutation (339)
    • Uniprot P14926 (12-417)
    Domains in SCOPe 2.07: d1oerd3, d1oerd4
  • Heterogens: NH4, DAO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oerA (A:)
    mrgshhhhhhgsmkrvvitglgivssignnqqevlaslregrsgitfsqelkdsgmrshv
    wgnvkldttglidrkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsggg
    sprfqvfgadamrgprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsah
    cignaveqiqlgkqdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdg
    fviaggggmvvveelehalargahiyaeivgygatsdgadmvapsgegavrcmkmamhgv
    dtpidylnshgtstpvgdvkelaairevfgdkspaisataamtghslgakgvqeaiysll
    mlehgfiapsinieeldeqaaglnivtettdrelttvmsnsfgfggtnatlvmrklkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oerA (A:)
    mkrvvitglgivssignnqqevlaslregrsgitfsqelkdsgmrshvwgnvkldttgli
    drkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsgggsprfqvfgadam
    rgprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsahcignaveqiqlg
    kqdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdgfviaggggmvvv
    eelehalargahiyaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnshgt
    stpvgdvkelaairevfgdkspaisataamtghslgakgvqeaiysllmlehgfiapsin
    ieeldeqaaglnivtettdrelttvmsnsfgfggtnatlvmrklkd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1oerB (B:)
    mrgshhhhhhgsmkrvvitglgivssignnqqevlaslregrsgitfsqelkdsgmrshv
    wgnvkldttglidrkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsggg
    sprfqvfgadamrgprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsah
    cignaveqiqlgkqdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdg
    fviaggggmvvveelehalargahiyaeivgygatsdgadmvapsgegavrcmkmamhgv
    dtpidylnshgtstpvgdvkelaairevfgdkspaisataamtghslgakgvqeaiysll
    mlehgfiapsinieeldeqaaglnivtettdrelttvmsnsfgfggtnatlvmrklkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oerB (B:)
    mkrvvitglgivssignnqqevlaslregrsgitfsqelkdsgmrshvwgnvkldttgli
    drkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsgggsprfqvfgadam
    rgprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsahcignaveqiqlg
    kqdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdgfviaggggmvvv
    eelehalargahiyaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnshgt
    stpvgdvkelaairevfgdkspaisataamtghslgakgvqeaiysllmlehgfiapsin
    ieeldeqaaglnivtettdrelttvmsnsfgfggtnatlvmrklkd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1oerC (C:)
    mrgshhhhhhgsmkrvvitglgivssignnqqevlaslregrsgitfsqelkdsgmrshv
    wgnvkldttglidrkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsggg
    sprfqvfgadamrgprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsah
    cignaveqiqlgkqdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdg
    fviaggggmvvveelehalargahiyaeivgygatsdgadmvapsgegavrcmkmamhgv
    dtpidylnshgtstpvgdvkelaairevfgdkspaisataamtghslgakgvqeaiysll
    mlehgfiapsinieeldeqaaglnivtettdrelttvmsnsfgfggtnatlvmrklkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oerC (C:)
    mkrvvitglgivssignnqqevlaslregrsgitfsqelkdsgmrshvwgnvkldttgli
    drkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsgggsprfqvfgadam
    rgprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsahcignaveqiqlg
    kqdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdgfviaggggmvvv
    eelehalargahiyaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnshgt
    stpvgdvkelaairevfgdkspaisataamtghslgakgvqeaiysllmlehgfiapsin
    ieeldeqaaglnivtettdrelttvmsnsfgfggtnatlvmrklkd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1oerD (D:)
    mrgshhhhhhgsmkrvvitglgivssignnqqevlaslregrsgitfsqelkdsgmrshv
    wgnvkldttglidrkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsggg
    sprfqvfgadamrgprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsah
    cignaveqiqlgkqdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdg
    fviaggggmvvveelehalargahiyaeivgygatsdgadmvapsgegavrcmkmamhgv
    dtpidylnshgtstpvgdvkelaairevfgdkspaisataamtghslgakgvqeaiysll
    mlehgfiapsinieeldeqaaglnivtettdrelttvmsnsfgfggtnatlvmrklkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oerD (D:)
    mkrvvitglgivssignnqqevlaslregrsgitfsqelkdsgmrshvwgnvkldttgli
    drkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsgggsprfqvfgadam
    rgprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsahcignaveqiqlg
    kqdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdgfviaggggmvvv
    eelehalargahiyaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnshgt
    stpvgdvkelaairevfgdkspaisataamtghslgakgvqeaiysllmlehgfiapsin
    ieeldeqaaglnivtettdrelttvmsnsfgfggtnatlvmrklkd