PDB entry 1oeq

View 1oeq on RCSB PDB site
Description: structure of escherichia coli beta-ketoacyl [acyl carrier protein] synthase I lys328ala mutant
Class: transferase
Keywords: condensing enzyme, fatty acid biosynthesis, kas I, transferase
Deposited on 2003-03-31, released 2004-05-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2005-09-09, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.181
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-oxoacyl-[acyl-carrier-protein] synthase I
    Species: ESCHERICHIA COLI
    Database cross-references and differences (RAF-indexed):
    • PDB 1OEQ
      • engineered mutation (15)
      • engineered mutation (339)
    • Uniprot P14926 (12-417)
    Domains in SCOPe 2.07: d1oeqa3, d1oeqa4
  • Chain 'B':
    Compound: 3-oxoacyl-[acyl-carrier-protein] synthase I
    Species: ESCHERICHIA COLI
    Database cross-references and differences (RAF-indexed):
    • PDB 1OEQ
      • engineered mutation (15)
      • engineered mutation (339)
    • Uniprot P14926 (12-417)
    Domains in SCOPe 2.07: d1oeqb3, d1oeqb4
  • Chain 'C':
    Compound: 3-oxoacyl-[acyl-carrier-protein] synthase I
    Species: ESCHERICHIA COLI
    Database cross-references and differences (RAF-indexed):
    • PDB 1OEQ
      • engineered mutation (15)
      • engineered mutation (339)
    • Uniprot P14926 (12-417)
    Domains in SCOPe 2.07: d1oeqc3, d1oeqc4
  • Chain 'D':
    Compound: 3-oxoacyl-[acyl-carrier-protein] synthase I
    Species: ESCHERICHIA COLI
    Database cross-references and differences (RAF-indexed):
    • PDB 1OEQ
      • engineered mutation (15)
      • engineered mutation (339)
    • Uniprot P14926 (12-417)
    Domains in SCOPe 2.07: d1oeqd3, d1oeqd4
  • Heterogens: NH4, HYD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oeqA (A:)
    mrgshhhhhhgsmkrvvitglgivssignnqqevlaslregrsgitfsqelkdsgmrshv
    wgnvkldttglidrkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsggg
    sprfqvfgadamrgprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsah
    cignaveqiqlgkqdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdg
    fviaggggmvvveelehalargahiyaeivgygatsdgadmvapsgegavrcmkmamhgv
    dtpidylnshgtstpvgdvkelaairevfgdkspaisataamtghslgakgvqeaiysll
    mlehgfiapsinieeldeqaaglnivtettdrelttvmsnsfgfggtnatlvmrklkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oeqA (A:)
    mkrvvitglgivssignnqqevlaslregrsgitfsqelkdsgmrshvwgnvkldttgli
    drkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsgggsprfqvfgadam
    rgprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsahcignaveqiqlg
    kqdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdgfviaggggmvvv
    eelehalargahiyaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnshgt
    stpvgdvkelaairevfgdkspaisataamtghslgakgvqeaiysllmlehgfiapsin
    ieeldeqaaglnivtettdrelttvmsnsfgfggtnatlvmrklkd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1oeqB (B:)
    mrgshhhhhhgsmkrvvitglgivssignnqqevlaslregrsgitfsqelkdsgmrshv
    wgnvkldttglidrkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsggg
    sprfqvfgadamrgprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsah
    cignaveqiqlgkqdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdg
    fviaggggmvvveelehalargahiyaeivgygatsdgadmvapsgegavrcmkmamhgv
    dtpidylnshgtstpvgdvkelaairevfgdkspaisataamtghslgakgvqeaiysll
    mlehgfiapsinieeldeqaaglnivtettdrelttvmsnsfgfggtnatlvmrklkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oeqB (B:)
    mkrvvitglgivssignnqqevlaslregrsgitfsqelkdsgmrshvwgnvkldttgli
    drkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsgggsprfqvfgadam
    rgprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsahcignaveqiqlg
    kqdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdgfviaggggmvvv
    eelehalargahiyaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnshgt
    stpvgdvkelaairevfgdkspaisataamtghslgakgvqeaiysllmlehgfiapsin
    ieeldeqaaglnivtettdrelttvmsnsfgfggtnatlvmrklkd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1oeqC (C:)
    mrgshhhhhhgsmkrvvitglgivssignnqqevlaslregrsgitfsqelkdsgmrshv
    wgnvkldttglidrkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsggg
    sprfqvfgadamrgprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsah
    cignaveqiqlgkqdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdg
    fviaggggmvvveelehalargahiyaeivgygatsdgadmvapsgegavrcmkmamhgv
    dtpidylnshgtstpvgdvkelaairevfgdkspaisataamtghslgakgvqeaiysll
    mlehgfiapsinieeldeqaaglnivtettdrelttvmsnsfgfggtnatlvmrklkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oeqC (C:)
    mkrvvitglgivssignnqqevlaslregrsgitfsqelkdsgmrshvwgnvkldttgli
    drkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsgggsprfqvfgadam
    rgprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsahcignaveqiqlg
    kqdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdgfviaggggmvvv
    eelehalargahiyaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnshgt
    stpvgdvkelaairevfgdkspaisataamtghslgakgvqeaiysllmlehgfiapsin
    ieeldeqaaglnivtettdrelttvmsnsfgfggtnatlvmrklkd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1oeqD (D:)
    mrgshhhhhhgsmkrvvitglgivssignnqqevlaslregrsgitfsqelkdsgmrshv
    wgnvkldttglidrkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsggg
    sprfqvfgadamrgprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsah
    cignaveqiqlgkqdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdg
    fviaggggmvvveelehalargahiyaeivgygatsdgadmvapsgegavrcmkmamhgv
    dtpidylnshgtstpvgdvkelaairevfgdkspaisataamtghslgakgvqeaiysll
    mlehgfiapsinieeldeqaaglnivtettdrelttvmsnsfgfggtnatlvmrklkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oeqD (D:)
    mkrvvitglgivssignnqqevlaslregrsgitfsqelkdsgmrshvwgnvkldttgli
    drkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsgggsprfqvfgadam
    rgprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsahcignaveqiqlg
    kqdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdgfviaggggmvvv
    eelehalargahiyaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnshgt
    stpvgdvkelaairevfgdkspaisataamtghslgakgvqeaiysllmlehgfiapsin
    ieeldeqaaglnivtettdrelttvmsnsfgfggtnatlvmrklkd