PDB entry 1oep

View 1oep on RCSB PDB site
Description: structure of trypanosoma brucei enolase reveals the inhibitory divalent metal site
Deposited on 2003-03-28, released 2003-04-02
The last revision prior to the SCOP 1.71 freeze date was dated 2003-04-02, with a file datestamp of 2003-04-02.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.21
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oepA (A:)
    gshmtiqkvhgrevldsrgnptvevevttekgvfrsavpsgastgvyeacelrdgdkkry
    vgkgclqavknvnevigpaligrdelkqeeldtlmlrldgtpnkgklganailgcsmais
    kaaaaakgvplyrylaslagtkelrlpvpcfnvinggkhagnalpfqefmiapvkatsfs
    ealrmgsevyhslkgiikkkygqdavnvgdeggfappikdineplpilmeaieeaghrgk
    faicmdcaasetydekkqqynltfkspeptwvtaeqlretyckwahdypivsiedpydqd
    dfagfagitealkgktqivgddltvtnterikmaiekkacnslllkinqigtiseaiass
    klcmengwsvmvshrsgetedtyiadlvvalgsgqiktgapcrgertaklnqllrieeel
    gahakfgfpgws
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oepA (A:)
    shmtiqkvhgrevldsrgnptvevevttekgvfrsavpsgasvyeacelrdgdkkryvgk
    gclqavknvnevigpaligrdelkqeeldtlmlrldgtpnkgklganailgcsmaiskaa
    aaakgvplyrylaslagtkelrlpvpcfnvinggkhagnalpfqefmiapvkatsfseal
    rmgsevyhslkgiikkkygqdavnvgdeggfappikdineplpilmeaieeaghrgkfai
    cmdcaasetydekkqqynltwvtaeqlretyckwahdypivsiedpydqddfagfagite
    alkgktqivgddltvtnterikmaiekkacnslllkinqigtiseaiassklcmengwsv
    mvshrsgetedtyiadlvvalgsgqiktgapcrgertaklnqllrieeelgahakfgfpg
    ws