PDB entry 1oel

View 1oel on RCSB PDB site
Description: conformational variability in the refined structure of the chaperonin groEL at 2.8 angstrom resolution
Class: chaperonin
Keywords: chaperonin
Deposited on 1995-11-21, released 1996-04-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.227
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: groEL (hsp60 class)
    Species: Escherichia coli [TaxId:562]
    Gene: GROEL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6F5 (0-End)
      • engineered (11)
      • engineered (124)
    Domains in SCOPe 2.07: d1oela1, d1oela2, d1oela3
  • Chain 'B':
    Compound: groEL (hsp60 class)
    Species: Escherichia coli [TaxId:562]
    Gene: GROEL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6F5 (0-End)
      • engineered (11)
      • engineered (124)
    Domains in SCOPe 2.07: d1oelb1, d1oelb2, d1oelb3
  • Chain 'C':
    Compound: groEL (hsp60 class)
    Species: Escherichia coli [TaxId:562]
    Gene: GROEL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6F5 (0-End)
      • engineered (11)
      • engineered (124)
    Domains in SCOPe 2.07: d1oelc3, d1oelc4, d1oelc5
  • Chain 'D':
    Compound: groEL (hsp60 class)
    Species: Escherichia coli [TaxId:562]
    Gene: GROEL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6F5 (0-End)
      • engineered (11)
      • engineered (124)
    Domains in SCOPe 2.07: d1oeld1, d1oeld2, d1oeld3
  • Chain 'E':
    Compound: groEL (hsp60 class)
    Species: Escherichia coli [TaxId:562]
    Gene: GROEL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6F5 (0-End)
      • engineered (11)
      • engineered (124)
    Domains in SCOPe 2.07: d1oele1, d1oele2, d1oele3
  • Chain 'F':
    Compound: groEL (hsp60 class)
    Species: Escherichia coli [TaxId:562]
    Gene: GROEL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6F5 (0-End)
      • engineered (11)
      • engineered (124)
    Domains in SCOPe 2.07: d1oelf1, d1oelf2, d1oelf3
  • Chain 'G':
    Compound: groEL (hsp60 class)
    Species: Escherichia coli [TaxId:562]
    Gene: GROEL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6F5 (0-End)
      • engineered (11)
      • engineered (124)
    Domains in SCOPe 2.07: d1oelg1, d1oelg2, d1oelg3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oelA (A:)
    aakdvkfgndagvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtvaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatavvntirgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvalir
    vaskladlrgqnedqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpkndaadlgaaggmggm
    ggmggmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oelA (A:)
    aakdvkfgndagvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtvaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatavvntirgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvalir
    vaskladlrgqnedqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1oelB (B:)
    aakdvkfgndagvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtvaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatavvntirgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvalir
    vaskladlrgqnedqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpkndaadlgaaggmggm
    ggmggmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oelB (B:)
    aakdvkfgndagvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtvaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatavvntirgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvalir
    vaskladlrgqnedqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1oelC (C:)
    aakdvkfgndagvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtvaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatavvntirgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvalir
    vaskladlrgqnedqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpkndaadlgaaggmggm
    ggmggmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oelC (C:)
    aakdvkfgndagvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtvaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatavvntirgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvalir
    vaskladlrgqnedqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1oelD (D:)
    aakdvkfgndagvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtvaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatavvntirgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvalir
    vaskladlrgqnedqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpkndaadlgaaggmggm
    ggmggmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oelD (D:)
    aakdvkfgndagvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtvaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatavvntirgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvalir
    vaskladlrgqnedqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1oelE (E:)
    aakdvkfgndagvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtvaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatavvntirgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvalir
    vaskladlrgqnedqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpkndaadlgaaggmggm
    ggmggmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oelE (E:)
    aakdvkfgndagvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtvaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatavvntirgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvalir
    vaskladlrgqnedqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1oelF (F:)
    aakdvkfgndagvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtvaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatavvntirgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvalir
    vaskladlrgqnedqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpkndaadlgaaggmggm
    ggmggmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oelF (F:)
    aakdvkfgndagvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtvaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatavvntirgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvalir
    vaskladlrgqnedqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlp
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1oelG (G:)
    aakdvkfgndagvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtvaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatavvntirgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvalir
    vaskladlrgqnedqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpkndaadlgaaggmggm
    ggmggmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oelG (G:)
    aakdvkfgndagvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtvaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatavvntirgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvalir
    vaskladlrgqnedqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlp