PDB entry 1oe9

View 1oe9 on RCSB PDB site
Description: crystal structure of myosin v motor with essential light chain - nucleotide-free
Class: ATPase/myosin
Keywords: ATPase/myosin, unconventional myosin, myosin v, chicken, molecular motor, ATPase, elc, iq motif, muscle protein, ATP-binding
Deposited on 2003-03-21, released 2003-09-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.222
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: myosin va
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02440 (Start-791)
    • PDB 1OE9
    Domains in SCOPe 2.06: d1oe9a1, d1oe9a2
  • Chain 'B':
    Compound: myosin light chain 1, slow-twitch muscle a isoform
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1oe9b_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oe9A (A:)
    maaselytkyarvwipdpeevwksaellkdykpgdkvlqlrleegkdleycldpktkelp
    plrnpdilvgendltalsylhepavlhnlkvrfidskliytycgivlvainpyeqlpiyg
    ediinaysgqnmgdmdphifavaeeaykqmardernqsiivsgesgagktvsakyamryf
    atvsgsaseanveekvlasnpimesignakttrndnssrfgkyieigfdkryriiganmr
    tylleksrvvfqaeeernyhifyqlcasaalpefktlrlgnanyfhytkqggspvidgid
    dakemvntrqactllgisdsyqmgifrilagilhlgnvefasrdsdscaippkhdpltif
    cdlmgvdyeemahwlchrklatatetyikpisklhainardalakhiyanlfnwivdhvn
    kalhstvkqhsfigvldiygfetfeinsfeqfcinyaneklqqqfnmhvfkleqeeymke
    qipwtlidfydnqpcinlieakmgvldlldeeckmpkgsddtwaqklynthlnkcalfek
    prlsnkafiikhfadkveyqcegfleknkdtvyeeqikvlksskkfkllpelfqdeekai
    sptsatpsgrvplsrtpvkpakarpgqtskehkktvghqfrnslhllmetlnattphyvr
    cikpndfkfpftfdekravqqlracgvletirisaagfpsrwtyqeffsryrvlmkqkdv
    lsdrkqtcknvleklildkdkyqfgktkiffragqvaylekiradklraaciriqktirg
    wlmrkkymrmrrgda
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oe9A (A:)
    elytkyarvwipdpeevwksaellkdykpgdkvlqlrldleyclkelpplrnpdilvgen
    dltalsylhepavlhnlkvrfidskliytycgivlvainpyeqlpiygediinaysgqnm
    gdmdphifavaeeaykqmardernqsiivsgesgagktvsakyamryfatvsnveekvla
    snpimesignakttrndnssrfgkyieigfdkryriiganmrtylleksrvvfqaeeern
    yhifyqlcasaalpefktlrlgnanyfhytkqggspvidgiddakemvntrqactllgis
    dsyqmgifrilagilhlgnvefasrdsdscaippkhdpltifcdlmgvdyeemahwlchr
    klatyikpisklhainardalakhiyanlfnwivdhvnkalhstvkqhsfigvldiygfe
    tfeinsfeqfcinyaneklqqqfnmhvfkleqeeymkeqipdfydnqpcinlieakmgvl
    dlldeeckmpkgsddtwaqklynthlnkcalfekprlsnkafiikhfadkveyqcegfle
    knkdtvyeeqikvlksskkfkllpelfhkktvghqfrnslhllmetlnattphyvrcikp
    ndfkfpftfdekravqqlracgvletirisaagfpsrwtyqeffsryrvlmkqkdvlsdr
    kqtcknvleklildkdkyqfgktkiffragqvaylekiradklraaciriqktirgwlmr
    kkymrmrrgda
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1oe9B (B:)
    miefnkdqleefkeafelfdrvgdgkilysqcgdvmralgqnptnaevlkvlgnpksdel
    ksrrvdfetflpmlqavaknrgqgtyedylegfrvfdkegngkvmgaelrhvlttlgekm
    teeevetvlaghedsngcinyeaflkhilsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oe9B (B:)
    fnkdqleefkeafelfdrvgdgkilysqcgdvmralgqnptnaevlkvlgnpksdelksr
    rvdfetflpmlqavakyedylegfrvfdgngkvmgaelrhvlttlgekmteeevetvlag
    hedsngcinyeaflkhils