PDB entry 1oe6

View 1oe6 on RCSB PDB site
Description: Xenopus SMUG1, an anti-mutator uracil-DNA Glycosylase
Deposited on 2003-03-19, released 2003-07-11
The last revision prior to the SCOP 1.65 freeze date was dated 2003-07-11, with a file datestamp of 2003-07-11.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.15745
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1oe6a_
  • Chain 'B':
    Domains in SCOP 1.65: d1oe6b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oe6A (A:)
    tespadsflkvelelnlklsnlvfqdpvqyvynplvyawaphenyvqtyckskkevlflg
    mnpgpfgmaqtgvpfgevnhvrdwlqiegpvskpevehpkrrirgfecpqsevsgarfws
    lfkslcgqpetffkhcfvhnhcplifmnhsgknltptdlpkaqrdtlleicdealcqavr
    vlgvklvigvgrfseqrarkalmaegidvtvkgimhpsprnpqankgwegivrgqllelg
    vlslltg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oe6A (A:)
    spadsflkvelelnlklsnlvfqdpvqyvynplvyawaphenyvqtyckskkevlflgmn
    pgpfgmaqtgvpfgevnhvrdwlqiegpvskpevehpkrrirgfecpqsevsgarfwslf
    kslcgqpetffkhcfvhnhcplifmnhsgknltptdlpkaqrdtlleicdealcqavrvl
    gvklvigvgrfseqrarkalmaegidvtvkgimhpsprnpqankgwegivrgqllelgvl
    sllt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1oe6B (B:)
    tespadsflkvelelnlklsnlvfqdpvqyvynplvyawaphenyvqtyckskkevlflg
    mnpgpfgmaqtgvpfgevnhvrdwlqiegpvskpevehpkrrirgfecpqsevsgarfws
    lfkslcgqpetffkhcfvhnhcplifmnhsgknltptdlpkaqrdtlleicdealcqavr
    vlgvklvigvgrfseqrarkalmaegidvtvkgimhpsprnpqankgwegivrgqllelg
    vlslltg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oe6B (B:)
    espadsflkvelelnlklsnlvfqdpvqyvynplvyawaphenyvqtyckskkevlflgm
    npgpfgmaqtgvpfgevnhvrdwlqiegpvskpevehpkrrirgfecpqsevsgarfwsl
    fkslcgqpetffkhcfvhnhcplifmnhsgknltptdlpkaqrdtlleicdealcqavrv
    lgvklvigvgrfseqrarkalmaegidvtvkgimhpsprnpqankgwegivrgqllelgv
    lsllt