PDB entry 1oe6

View 1oe6 on RCSB PDB site
Description: Xenopus SMUG1, an anti-mutator uracil-DNA Glycosylase
Class: hydrolase/DNA
Keywords: hydrolase-DNA complex, hydrolase, DNA glycosylase, single stranded
Deposited on 2003-03-19, released 2003-07-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-07-17, with a file datestamp of 2013-07-12.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.157
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: single-strand selective monofunctional uracil DNA glycosylase
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1oe6a_
  • Chain 'B':
    Compound: single-strand selective monofunctional uracil DNA glycosylase
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1oe6b_
  • Chain 'E':
    Compound: 5'-d(*cp*cp*cp*gp*tp*gp*ap*gp*tp*cp*cp*g)-3'
  • Chain 'F':
    Compound: 5'-d(*cp*gp*gp*ap*cp*tp*3drp*ap*cp*gp*gp*g)-3'
  • Heterogens: HMU, GOL, IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oe6A (A:)
    tespadsflkvelelnlklsnlvfqdpvqyvynplvyawaphenyvqtyckskkevlflg
    mnpgpfgmaqtgvpfgevnhvrdwlqiegpvskpevehpkrrirgfecpqsevsgarfws
    lfkslcgqpetffkhcfvhnhcplifmnhsgknltptdlpkaqrdtlleicdealcqavr
    vlgvklvigvgrfseqrarkalmaegidvtvkgimhpsprnpqankgwegivrgqllelg
    vlslltg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oe6A (A:)
    spadsflkvelelnlklsnlvfqdpvqyvynplvyawaphenyvqtyckskkevlflgmn
    pgpfgmaqtgvpfgevnhvrdwlqiegpvskpevehpkrrirgfecpqsevsgarfwslf
    kslcgqpetffkhcfvhnhcplifmnhsgknltptdlpkaqrdtlleicdealcqavrvl
    gvklvigvgrfseqrarkalmaegidvtvkgimhpsprnpqankgwegivrgqllelgvl
    sllt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1oe6B (B:)
    tespadsflkvelelnlklsnlvfqdpvqyvynplvyawaphenyvqtyckskkevlflg
    mnpgpfgmaqtgvpfgevnhvrdwlqiegpvskpevehpkrrirgfecpqsevsgarfws
    lfkslcgqpetffkhcfvhnhcplifmnhsgknltptdlpkaqrdtlleicdealcqavr
    vlgvklvigvgrfseqrarkalmaegidvtvkgimhpsprnpqankgwegivrgqllelg
    vlslltg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oe6B (B:)
    espadsflkvelelnlklsnlvfqdpvqyvynplvyawaphenyvqtyckskkevlflgm
    npgpfgmaqtgvpfgevnhvrdwlqiegpvskpevehpkrrirgfecpqsevsgarfwsl
    fkslcgqpetffkhcfvhnhcplifmnhsgknltptdlpkaqrdtlleicdealcqavrv
    lgvklvigvgrfseqrarkalmaegidvtvkgimhpsprnpqankgwegivrgqllelgv
    lsllt
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.