PDB entry 1ody

View 1ody on RCSB PDB site
Description: hiv-1 protease complexed with an inhibitor lp-130
Deposited on 1998-07-13, released 1999-02-16
The last revision prior to the SCOP 1.71 freeze date was dated 1999-02-16, with a file datestamp of 1999-02-16.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.167
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1odya_
  • Chain 'B':
    Domains in SCOP 1.71: d1odyb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1odyA (A:)
    pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgawkpkmiggiggfikvrqyd
    qilieicghkaigtvlvgptpvniigrnlltqigctlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1odyB (B:)
    pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgawkpkaiggiggfikvrqyd
    qilieicghkaigtvlvgptpvniigrnlltqigctlnf