PDB entry 1odx

View 1odx on RCSB PDB site
Description: HIV-1 Proteinase mutant A71T, V82A
Deposited on 1996-09-16, released 1997-04-01
The last revision prior to the SCOP 1.71 freeze date was dated 1997-04-01, with a file datestamp of 1997-04-02.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.166
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1odxa_
  • Chain 'B':
    Domains in SCOP 1.71: d1odxb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1odxA (A:)
pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qilieicghktigtvlvgptpaniigrnlltqigctlnf

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1odxB (B:)
pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qilieicghktigtvlvgptpaniigrnlltqigctlnf