PDB entry 1odo

View 1odo on RCSB PDB site
Description: 1.85 A structure of CYP154A1 from Streptomyces coelicolor A3(2)
Class: oxidoreductase
Keywords: p450 monooxygenase, streptomyces, cytochrome, oxidoreductase
Deposited on 2003-02-19, released 2004-01-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-04-15, with a file datestamp of 2015-04-10.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative cytochrome p450 154a1
    Species: STREPTOMYCES COELICOLOR [TaxId:100226]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1odoa_
  • Heterogens: HEM, PIM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1odoA (A:)
    matqqpalvldptgadhhtehrtlreggpatwvdvlgvqawsvsdpvllkqlltssdvsk
    darahwpafgevvgtwplalwvavenmftaygpnhrklrrlvapafsarrvdamrpavea
    mvtglvdrlaelpagepvdlrqelayplpiavighlmgvpqdrrdgfralvdgvfdttld
    qaeaqantarlyevldqliaakratpgddmtslliaarddegdgdrlspeelrdtlllmi
    sagyettvnvidqavhtlltrpdqlalvrkgevtwadvveetlrhepavkhlplryavtd
    ialpdgrtiargepilasyaaanrhpdwhedadtfdatrtvkehlafghgvhfclgapla
    rmevtlaleslfgrfpdlrladpaeelppvpslisnghqrlpvllhag
    

    Sequence, based on observed residues (ATOM records): (download)
    >1odoA (A:)
    alvldptgadhhtehrtlreggpatwvdvlgvqawsvsdpvllkqlltssdvskdarahw
    pafgevvgtwplalwvavenmftaygpnhrklrrlvapafsarrvdamrpaveamvtglv
    drlaelpagepvdlrqelayplpiavighlmgvpqdrrdgfralvdgvfdttldqaeaqa
    ntarlyevldqliaakratpgddmtslliaarddrlspeelrdtlllmisagyettvnvi
    dqavhtlltrpdqlalvrkgevtwadvveetlrhepavkhlplryavtdialpdgrtiar
    gepilasyaaanrhpdwhedadtfdatrtvkehlafghgvhfclgaplarmevtlalesl
    fgrfpdlrladpaeelppvpslisnghqrlpvllha