PDB entry 1odl

View 1odl on RCSB PDB site
Description: purine nucleoside phosphorylase from thermus thermophilus
Deposited on 2003-02-19, released 2003-02-27
The last revision prior to the SCOP 1.67 freeze date was dated 2004-04-01, with a file datestamp of 2004-04-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.187
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1odla_
  • Chain 'B':
    Domains in SCOP 1.67: d1odlb_
  • Chain 'C':
    Domains in SCOP 1.67: d1odlc_
  • Chain 'D':
    Domains in SCOP 1.67: d1odld_
  • Chain 'E':
    Domains in SCOP 1.67: d1odle_
  • Chain 'F':
    Domains in SCOP 1.67: d1odlf_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1odlA (A:)
    mspihvrahpgdvaervllpgdpgraewiaktflqnprryndhrglwgytglykgvpvsv
    qttgmgtpsaaivveelvrlgarvlvrvgtagaassdlapgelivaqgavpldgttrqyl
    egrpyapvpdpevfralwrraealgyphrvglvasedafyattpeearawarygvlafem
    easalfllgrmrgvrtgailavsnrigdpelappevlqegvrrmvevaleavlev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1odlA (A:)
    spihvrahpgdvaervllpgdpgraewiaktflqnprryndhrglwgytglykgvpvsvq
    ttgmgtpsaaivveelvrlgarvlvrvgtagaassdlapgelivaqgavpldgttrqyle
    grpyapvpdpevfralwrraealgyphrvglvasedafyattpeearawarygvlafeme
    asalfllgrmrgvrtgailavsnrigdpelappevlqegvrrmvevaleavlev
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1odlB (B:)
    mspihvrahpgdvaervllpgdpgraewiaktflqnprryndhrglwgytglykgvpvsv
    qttgmgtpsaaivveelvrlgarvlvrvgtagaassdlapgelivaqgavpldgttrqyl
    egrpyapvpdpevfralwrraealgyphrvglvasedafyattpeearawarygvlafem
    easalfllgrmrgvrtgailavsnrigdpelappevlqegvrrmvevaleavlev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1odlB (B:)
    spihvrahpgdvaervllpgdpgraewiaktflqnprryndhrglwgytglykgvpvsvq
    ttgmgtpsaaivveelvrlgarvlvrvgtagaassdlapgelivaqgavpldgttrqyle
    grpyapvpdpevfralwrraealgyphrvglvasedafyattpeearawarygvlafeme
    asalfllgrmrgvrtgailavsnrigdpelappevlqegvrrmvevaleavlev
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1odlC (C:)
    mspihvrahpgdvaervllpgdpgraewiaktflqnprryndhrglwgytglykgvpvsv
    qttgmgtpsaaivveelvrlgarvlvrvgtagaassdlapgelivaqgavpldgttrqyl
    egrpyapvpdpevfralwrraealgyphrvglvasedafyattpeearawarygvlafem
    easalfllgrmrgvrtgailavsnrigdpelappevlqegvrrmvevaleavlev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1odlC (C:)
    spihvrahpgdvaervllpgdpgraewiaktflqnprryndhrglwgytglykgvpvsvq
    ttgmgtpsaaivveelvrlgarvlvrvgtagaassdlapgelivaqgavpldgttrqyle
    grpyapvpdpevfralwrraealgyphrvglvasedafyattpeearawarygvlafeme
    asalfllgrmrgvrtgailavsnrigdpelappevlqegvrrmvevaleavlev
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1odlD (D:)
    mspihvrahpgdvaervllpgdpgraewiaktflqnprryndhrglwgytglykgvpvsv
    qttgmgtpsaaivveelvrlgarvlvrvgtagaassdlapgelivaqgavpldgttrqyl
    egrpyapvpdpevfralwrraealgyphrvglvasedafyattpeearawarygvlafem
    easalfllgrmrgvrtgailavsnrigdpelappevlqegvrrmvevaleavlev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1odlD (D:)
    spihvrahpgdvaervllpgdpgraewiaktflqnprryndhrglwgytglykgvpvsvq
    ttgmgtpsaaivveelvrlgarvlvrvgtagaassdlapgelivaqgavpldgttrqyle
    grpyapvpdpevfralwrraealgyphrvglvasedafyattpeearawarygvlafeme
    asalfllgrmrgvrtgailavsnrigdpelappevlqegvrrmvevaleavlev
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1odlE (E:)
    mspihvrahpgdvaervllpgdpgraewiaktflqnprryndhrglwgytglykgvpvsv
    qttgmgtpsaaivveelvrlgarvlvrvgtagaassdlapgelivaqgavpldgttrqyl
    egrpyapvpdpevfralwrraealgyphrvglvasedafyattpeearawarygvlafem
    easalfllgrmrgvrtgailavsnrigdpelappevlqegvrrmvevaleavlev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1odlE (E:)
    spihvrahpgdvaervllpgdpgraewiaktflqnprryndhrglwgytglykgvpvsvq
    ttgmgtpsaaivveelvrlgarvlvrvgtagaassdlapgelivaqgavpldgttrqyle
    grpyapvpdpevfralwrraealgyphrvglvasedafyattpeearawarygvlafeme
    asalfllgrmrgvrtgailavsnrigdpelappevlqegvrrmvevaleavlev
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1odlF (F:)
    mspihvrahpgdvaervllpgdpgraewiaktflqnprryndhrglwgytglykgvpvsv
    qttgmgtpsaaivveelvrlgarvlvrvgtagaassdlapgelivaqgavpldgttrqyl
    egrpyapvpdpevfralwrraealgyphrvglvasedafyattpeearawarygvlafem
    easalfllgrmrgvrtgailavsnrigdpelappevlqegvrrmvevaleavlev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1odlF (F:)
    spihvrahpgdvaervllpgdpgraewiaktflqnprryndhrglwgytglykgvpvsvq
    ttgmgtpsaaivveelvrlgarvlvrvgtagaassdlapgelivaqgavpldgttrqyle
    grpyapvpdpevfralwrraealgyphrvglvasedafyattpeearawarygvlafeme
    asalfllgrmrgvrtgailavsnrigdpelappevlqegvrrmvevaleavlev