PDB entry 1odk

View 1odk on RCSB PDB site
Description: purine nucleoside phosphorylase from thermus thermophilus
Deposited on 2003-02-19, released 2003-02-27
The last revision prior to the SCOP 1.67 freeze date was dated 2003-02-27, with a file datestamp of 2003-02-27.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.18
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    no info in PDB for this chain
  • Chain 'B':
    no info in PDB for this chain
  • Chain 'C':
    Domains in SCOP 1.67: d1odkc_
  • Chain 'D':
    no info in PDB for this chain
  • Chain 'E':
    no info in PDB for this chain
  • Chain 'F':
    no info in PDB for this chain

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1odkC (C:)
    mspihvrahpgdvaervllpgdpgraewiaktflqnprryndhrglwgytglykgvpvsv
    qttgmgtpsaaivveelvrlgarvlvrvgtagaassdlapgelivaqgavpldgttrqyl
    egrpyapvpdpevfralwrraealgyphrvglvasedafyattpeearawarygvlafem
    easalfllgrmrgvrtgailavsnrigdpelappevlqegvrrmvevaleavlev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1odkC (C:)
    spihvrahpgdvaervllpgdpgraewiaktflqnprryndhrglwgytglykgvpvsvq
    ttgmgtpsaaivveelvrlgarvlvrvgtagaassdlapgelivaqgavpldgttrqyle
    grpyapvpdpevfralwrraealgyphrvglvasedafyattpeearawarygvlafeme
    asalfllgrmrgvrtgailavsnrippevlqegvrrmvevaleavlev
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.