PDB entry 1odj

View 1odj on RCSB PDB site
Description: purine nucleoside phosphorylase from thermus thermophilus
Deposited on 2003-02-19, released 2003-03-04
The last revision prior to the SCOP 1.67 freeze date was dated 2004-04-01, with a file datestamp of 2004-04-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.221
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1odja_
  • Chain 'B':
    Domains in SCOP 1.67: d1odjb_
  • Chain 'C':
    Domains in SCOP 1.67: d1odjc_
  • Chain 'D':
    Domains in SCOP 1.67: d1odjd_
  • Chain 'E':
    Domains in SCOP 1.67: d1odje_
  • Chain 'F':
    Domains in SCOP 1.67: d1odjf_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1odjA (A:)
    mspihvrahpgdvaervllpgdpgraewiaktflqnprryndhrglwgytglykgvpvsv
    qttgmgtpsaaivveelvrlgarvlvrvgtagaassdlapgelivaqgavpldgttrqyl
    egrpyapvpdpevfralwrraealgyphrvglvasedafyattpeearawarygvlafem
    easalfllgrmrgvrtgailavsnrigdpelappevlqegvrrmvevaleavlev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1odjA (A:)
    spihvrahpgdvaervllpgdpgraewiaktflqnprryndhrglwgytglykgvpvsvq
    ttgmgtpsaaivveelvrlgarvlvrvgtagaassdlapgelivaqgavpldgttrqyle
    grpyapvpdpevfralwrraealgyphrvglvasedafyattpeearawarygvlafeme
    asalfllgrmrgvrtgailavsnrigdpelappevlqegvrrmvevaleavlev
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1odjB (B:)
    mspihvrahpgdvaervllpgdpgraewiaktflqnprryndhrglwgytglykgvpvsv
    qttgmgtpsaaivveelvrlgarvlvrvgtagaassdlapgelivaqgavpldgttrqyl
    egrpyapvpdpevfralwrraealgyphrvglvasedafyattpeearawarygvlafem
    easalfllgrmrgvrtgailavsnrigdpelappevlqegvrrmvevaleavlev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1odjB (B:)
    spihvrahpgdvaervllpgdpgraewiaktflqnprryndhrglwgytglykgvpvsvq
    ttgmgtpsaaivveelvrlgarvlvrvgtagaassdlapgelivaqgavpldgttrqyle
    grpyapvpdpevfralwrraealgyphrvglvasedafyattpeearawarygvlafeme
    asalfllgrmrgvrtgailavsnrigdpelappevlqegvrrmvevaleavlev
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1odjC (C:)
    mspihvrahpgdvaervllpgdpgraewiaktflqnprryndhrglwgytglykgvpvsv
    qttgmgtpsaaivveelvrlgarvlvrvgtagaassdlapgelivaqgavpldgttrqyl
    egrpyapvpdpevfralwrraealgyphrvglvasedafyattpeearawarygvlafem
    easalfllgrmrgvrtgailavsnrigdpelappevlqegvrrmvevaleavlev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1odjC (C:)
    spihvrahpgdvaervllpgdpgraewiaktflqnprryndhrglwgytglykgvpvsvq
    ttgmgtpsaaivveelvrlgarvlvrvgtagaassdlapgelivaqgavpldgttrqyle
    grpyapvpdpevfralwrraealgyphrvglvasedafyattpeearawarygvlafeme
    asalfllgrmrgvrtgailavsnrigdpelappevlqegvrrmvevaleavlev
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1odjD (D:)
    mspihvrahpgdvaervllpgdpgraewiaktflqnprryndhrglwgytglykgvpvsv
    qttgmgtpsaaivveelvrlgarvlvrvgtagaassdlapgelivaqgavpldgttrqyl
    egrpyapvpdpevfralwrraealgyphrvglvasedafyattpeearawarygvlafem
    easalfllgrmrgvrtgailavsnrigdpelappevlqegvrrmvevaleavlev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1odjD (D:)
    spihvrahpgdvaervllpgdpgraewiaktflqnprryndhrglwgytglykgvpvsvq
    ttgmgtpsaaivveelvrlgarvlvrvgtagaassdlapgelivaqgavpldgttrqyle
    grpyapvpdpevfralwrraealgyphrvglvasedafyattpeearawarygvlafeme
    asalfllgrmrgvrtgailavsnrigdpelappevlqegvrrmvevaleavlev
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1odjE (E:)
    mspihvrahpgdvaervllpgdpgraewiaktflqnprryndhrglwgytglykgvpvsv
    qttgmgtpsaaivveelvrlgarvlvrvgtagaassdlapgelivaqgavpldgttrqyl
    egrpyapvpdpevfralwrraealgyphrvglvasedafyattpeearawarygvlafem
    easalfllgrmrgvrtgailavsnrigdpelappevlqegvrrmvevaleavlev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1odjE (E:)
    spihvrahpgdvaervllpgdpgraewiaktflqnprryndhrglwgytglykgvpvsvq
    ttgmgtpsaaivveelvrlgarvlvrvgtagaassdlapgelivaqgavpldgttrqyle
    grpyapvpdpevfralwrraealgyphrvglvasedafyattpeearawarygvlafeme
    asalfllgrmrgvrtgailavsnrigdpelappevlqegvrrmvevaleavlev
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1odjF (F:)
    mspihvrahpgdvaervllpgdpgraewiaktflqnprryndhrglwgytglykgvpvsv
    qttgmgtpsaaivveelvrlgarvlvrvgtagaassdlapgelivaqgavpldgttrqyl
    egrpyapvpdpevfralwrraealgyphrvglvasedafyattpeearawarygvlafem
    easalfllgrmrgvrtgailavsnrigdpelappevlqegvrrmvevaleavlev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1odjF (F:)
    spihvrahpgdvaervllpgdpgraewiaktflqnprryndhrglwgytglykgvpvsvq
    ttgmgtpsaaivveelvrlgarvlvrvgtagaassdlapgelivaqgavpldgttrqyle
    grpyapvpdpevfralwrraealgyphrvglvasedafyattpeearawarygvlafeme
    asalfllgrmrgvrtgailavsnrigdpelappevlqegvrrmvevaleavlev