PDB entry 1odi

View 1odi on RCSB PDB site
Description: purine nucleoside phosphorylase from thermus thermophilus
Deposited on 2003-02-19, released 2003-02-27
The last revision prior to the SCOP 1.67 freeze date was dated 2003-02-27, with a file datestamp of 2003-02-27.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.176
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1odia_
  • Chain 'B':
    Domains in SCOP 1.67: d1odib_
  • Chain 'C':
    Domains in SCOP 1.67: d1odic_
  • Chain 'D':
    Domains in SCOP 1.67: d1odid_
  • Chain 'E':
    Domains in SCOP 1.67: d1odie_
  • Chain 'F':
    Domains in SCOP 1.67: d1odif_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1odiA (A:)
    mspihvrahpgdvaervllpgdpgraewiaktflqnprryndhrglwgytglykgvpvsv
    qttgmgtpsaaivveelvrlgarvlvrvgtagaassdlapgelivaqgavpldgttrqyl
    egrpyapvpdpevfralwrraealgyphrvglvasedafyattpeearawarygvlafem
    easalfllgrmrgvrtgailavsnrigdpelappevlqegvrrmvevaleavlev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1odiA (A:)
    spihvrahpgdvaervllpgdpgraewiaktflqnprryndhrglwgytglykgvpvsvq
    ttgmgtpsaaivveelvrlgarvlvrvgtagaassdlapgelivaqgavpldgttrqyle
    grpyapvpdpevfralwrraealgyphrvglvasedafyattpeearawarygvlafeme
    asalfllgrmrgvrtgailavsnrigdpelappevlqegvrrmvevaleavlev
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1odiB (B:)
    mspihvrahpgdvaervllpgdpgraewiaktflqnprryndhrglwgytglykgvpvsv
    qttgmgtpsaaivveelvrlgarvlvrvgtagaassdlapgelivaqgavpldgttrqyl
    egrpyapvpdpevfralwrraealgyphrvglvasedafyattpeearawarygvlafem
    easalfllgrmrgvrtgailavsnrigdpelappevlqegvrrmvevaleavlev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1odiB (B:)
    spihvrahpgdvaervllpgdpgraewiaktflqnprryndhrglwgytglykgvpvsvq
    ttgmgtpsaaivveelvrlgarvlvrvgtagaassdlapgelivaqgavpldgttrqyle
    grpyapvpdpevfralwrraealgyphrvglvasedafyattpeearawarygvlafeme
    asalfllgrmrgvrtgailavsnrigdpelappevlqegvrrmvevaleavlev
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1odiC (C:)
    mspihvrahpgdvaervllpgdpgraewiaktflqnprryndhrglwgytglykgvpvsv
    qttgmgtpsaaivveelvrlgarvlvrvgtagaassdlapgelivaqgavpldgttrqyl
    egrpyapvpdpevfralwrraealgyphrvglvasedafyattpeearawarygvlafem
    easalfllgrmrgvrtgailavsnrigdpelappevlqegvrrmvevaleavlev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1odiC (C:)
    spihvrahpgdvaervllpgdpgraewiaktflqnprryndhrglwgytglykgvpvsvq
    ttgmgtpsaaivveelvrlgarvlvrvgtagaassdlapgelivaqgavpldgttrqyle
    grpyapvpdpevfralwrraealgyphrvglvasedafyattpeearawarygvlafeme
    asalfllgrmrgvrtgailavsnrigdpelappevlqegvrrmvevaleavlev
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1odiD (D:)
    mspihvrahpgdvaervllpgdpgraewiaktflqnprryndhrglwgytglykgvpvsv
    qttgmgtpsaaivveelvrlgarvlvrvgtagaassdlapgelivaqgavpldgttrqyl
    egrpyapvpdpevfralwrraealgyphrvglvasedafyattpeearawarygvlafem
    easalfllgrmrgvrtgailavsnrigdpelappevlqegvrrmvevaleavlev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1odiD (D:)
    spihvrahpgdvaervllpgdpgraewiaktflqnprryndhrglwgytglykgvpvsvq
    ttgmgtpsaaivveelvrlgarvlvrvgtagaassdlapgelivaqgavpldgttrqyle
    grpyapvpdpevfralwrraealgyphrvglvasedafyattpeearawarygvlafeme
    asalfllgrmrgvrtgailavsnrigdpelappevlqegvrrmvevaleavlev
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1odiE (E:)
    mspihvrahpgdvaervllpgdpgraewiaktflqnprryndhrglwgytglykgvpvsv
    qttgmgtpsaaivveelvrlgarvlvrvgtagaassdlapgelivaqgavpldgttrqyl
    egrpyapvpdpevfralwrraealgyphrvglvasedafyattpeearawarygvlafem
    easalfllgrmrgvrtgailavsnrigdpelappevlqegvrrmvevaleavlev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1odiE (E:)
    spihvrahpgdvaervllpgdpgraewiaktflqnprryndhrglwgytglykgvpvsvq
    ttgmgtpsaaivveelvrlgarvlvrvgtagaassdlapgelivaqgavpldgttrqyle
    grpyapvpdpevfralwrraealgyphrvglvasedafyattpeearawarygvlafeme
    asalfllgrmrgvrtgailavsnrigdpelappevlqegvrrmvevaleavlev
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1odiF (F:)
    mspihvrahpgdvaervllpgdpgraewiaktflqnprryndhrglwgytglykgvpvsv
    qttgmgtpsaaivveelvrlgarvlvrvgtagaassdlapgelivaqgavpldgttrqyl
    egrpyapvpdpevfralwrraealgyphrvglvasedafyattpeearawarygvlafem
    easalfllgrmrgvrtgailavsnrigdpelappevlqegvrrmvevaleavlev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1odiF (F:)
    spihvrahpgdvaervllpgdpgraewiaktflqnprryndhrglwgytglykgvpvsvq
    ttgmgtpsaaivveelvrlgarvlvrvgtagaassdlapgelivaqgavpldgttrqyle
    grpyapvpdpevfralwrraealgyphrvglvasedafyattpeearawarygvlafeme
    asalfllgrmrgvrtgailavsnrigdpelappevlqegvrrmvevaleavlev