PDB entry 1odf

View 1odf on RCSB PDB site
Description: structure of ygr205w protein.
Class: yeast protein
Keywords: yeast protein, ATP binding protein
Deposited on 2003-02-19, released 2003-12-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.2063
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical 33.3 kda protein in ade3-ser2 intergenic region
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1odfa_
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1odfA (A:)
    mcdksktvldytiefldkyipewfetgnkcplfiffsgpqgsgksftsiqiynhlmekyg
    geksigyasiddfylthedqlklneqfknnkllqgrglpgthdmkllqevlntifnnneh
    pdqdtvvlpkydksqfkgegdrcptgqkiklpvdifilegwflgfnpilqgienndlltg
    dmvdvnaklffysdllwrnpeikslgivfttdninnvygwrlqqeheliskvgkgmtdeq
    vhafvdrympsyklylndfvrseslgsiatltlgidsnrnvystktrcie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1odfA (A:)
    sktvldytiefldkyipewfetgnkcplfiffsgpqgsgksftsiqiynhlmekyggeks
    igyasiddfylthedqlklneqfknnkllqgrglpgthdmkllqevlntifnqdtvvlpk
    ydksqfkgegdrcptgqkiklpvdifilegwflgfnpilqgienndlltgdmvdvnaklf
    fysdllwrnpeikslgivfttdninnvygwrlqqeheliskvgkgmtdeqvhafvdrymp
    syklylndfvrseslgsiatltlgidsnrnvystktrcie