PDB entry 1odf

View 1odf on RCSB PDB site
Description: structure of ygr205w protein.
Deposited on 2003-02-19, released 2003-12-12
The last revision prior to the SCOP 1.67 freeze date was dated 2003-12-12, with a file datestamp of 2003-12-12.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.2063
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1odfa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1odfA (A:)
    mcdksktvldytiefldkyipewfetgnkcplfiffsgpqgsgksftsiqiynhlmekyg
    geksigyasiddfylthedqlklneqfknnkllqgrglpgthdmkllqevlntifnnneh
    pdqdtvvlpkydksqfkgegdrcptgqkiklpvdifilegwflgfnpilqgienndlltg
    dmvdvnaklffysdllwrnpeikslgivfttdninnvygwrlqqeheliskvgkgmtdeq
    vhafvdrympsyklylndfvrseslgsiatltlgidsnrnvystktrcie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1odfA (A:)
    sktvldytiefldkyipewfetgnkcplfiffsgpqgsgksftsiqiynhlmekyggeks
    igyasiddfylthedqlklneqfknnkllqgrglpgthdmkllqevlntifnqdtvvlpk
    ydksqfkgegdrcptgqkiklpvdifilegwflgfnpilqgienndlltgdmvdvnaklf
    fysdllwrnpeikslgivfttdninnvygwrlqqeheliskvgkgmtdeqvhafvdrymp
    syklylndfvrseslgsiatltlgidsnrnvystktrcie